Comparing WP_076477793.1 NCBI__GCF_900156495.1:WP_076477793.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WG43 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
77% identity, 99% coverage: 3:262/262 of query aligns to 2:261/261 of P9WG43
3taoA Structure of mycobacterium tuberculosis triosephosphate isomerase bound to phosphoglycolohydroxamate (see paper)
76% identity, 98% coverage: 3:258/262 of query aligns to 1:256/256 of 3taoA
P27876 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Bacillus subtilis (strain 168) (see paper)
48% identity, 95% coverage: 4:252/262 of query aligns to 2:246/253 of P27876
3uwvA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 2-phosphoglyceric acid (see paper)
47% identity, 95% coverage: 4:252/262 of query aligns to 4:250/255 of 3uwvA
3uwzA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-2-phosphate (see paper)
47% identity, 95% coverage: 4:252/262 of query aligns to 3:249/254 of 3uwzA
3uwwA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 3-phosphoglyceric acid (see paper)
47% identity, 95% coverage: 4:252/262 of query aligns to 3:249/254 of 3uwwA
3uwuA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-3-phosphate (see paper)
47% identity, 95% coverage: 4:252/262 of query aligns to 2:248/253 of 3uwuA
Q6GIL6 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Staphylococcus aureus (strain MRSA252) (see paper)
47% identity, 95% coverage: 4:252/262 of query aligns to 2:248/253 of Q6GIL6
P00943 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
43% identity, 95% coverage: 4:252/262 of query aligns to 2:246/253 of P00943
1btmA Triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid (see paper)
43% identity, 95% coverage: 4:252/262 of query aligns to 1:245/251 of 1btmA
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
44% identity, 98% coverage: 3:258/262 of query aligns to 401:651/654 of P36204
Sites not aligning to the query:
4y96A Crystal structure of triosephosphate isomerase from gemmata obscuriglobus (see paper)
45% identity, 94% coverage: 3:249/262 of query aligns to 1:242/250 of 4y96A
3uwzB Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-2-phosphate (see paper)
45% identity, 95% coverage: 4:252/262 of query aligns to 2:245/250 of 3uwzB
4y90A Crystal structure of triosephosphate isomerase from deinococcus radiodurans (see paper)
51% identity, 91% coverage: 7:245/262 of query aligns to 4:232/244 of 4y90A
6neeB Crystal structure of a reconstructed ancestor of triosephosphate isomerase from eukaryotes (see paper)
44% identity, 95% coverage: 1:249/262 of query aligns to 1:244/252 of 6neeB
8w06B Crystal structure of the reconstruction of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by maximum likelihood with pgh (see paper)
44% identity, 93% coverage: 4:247/262 of query aligns to 4:241/251 of 8w06B
4mvaA 1.43 angstrom resolution crystal structure of triosephosphate isomerase (tpia) from escherichia coli in complex with acetyl phosphate. (see paper)
41% identity, 95% coverage: 4:252/262 of query aligns to 2:245/255 of 4mvaA
B1XB85 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Escherichia coli (strain K12 / DH10B) (see paper)
41% identity, 95% coverage: 4:252/262 of query aligns to 2:245/255 of B1XB85
5zfxB Crystal structure of triosephosphate isomerase from opisthorchis viverrini (see paper)
43% identity, 95% coverage: 4:253/262 of query aligns to 1:244/248 of 5zfxB
P50921 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Moritella marina (Vibrio marinus) (see paper)
41% identity, 92% coverage: 4:244/262 of query aligns to 2:239/256 of P50921
>WP_076477793.1 NCBI__GCF_900156495.1:WP_076477793.1
MANRTPLIAGNWKMNLNHLEAIALVQKIAFALPAKYFDKVDVTVLPPFTDIRSVQTVVDG
DKLLLTYGAQDLSQHDSGAYTGDISGAFLAKLGCSYVVVGHSERRTLHGETDEIVAAKAK
AAIDHGIVPIVCIGEPLEVREAGEHVAHCVAQVKGSLAGLSAEQIGRTVLAYEPVWAIGT
GRVASADDAQEVCAAVRDAIAQLADQAVADEVRVLYGGSVGSKNVGELVGKPDVDGALVG
GASLKSDEFATLCAIAAGGPLP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory