SitesBLAST
Comparing WP_076581962.1 NCBI__GCF_001971705.1:WP_076581962.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
3oa4A Crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125
36% identity, 99% coverage: 2:127/127 of query aligns to 4:132/138 of 3oa4A
6wf6A Streptomyces coelicolor methylmalonyl-coa epimerase (see paper)
38% identity, 98% coverage: 2:125/127 of query aligns to 4:136/141 of 6wf6A
6xbqA Streptomyces coelicolor methylmalonyl-coa epimerase in complex with carboxy-carba(dethia)-coa
38% identity, 98% coverage: 2:125/127 of query aligns to 4:136/144 of 6xbqA
- active site: H7 (= H5), E43 (≠ V39), Q60 (≠ E50), H84 (= H73), E134 (= E123)
- binding carboxymethyldethia coenzyme *a: Q39 (≠ D35), Q60 (≠ E50), A70 (≠ T59), K73 (≠ Q62), W74 (≠ Y63), H83 (= H72), H84 (= H73), L107 (≠ I96), F122 (= F111), P125 (= P114), K126 (= K115), L132 (= L121)
- binding cobalt (ii) ion: H7 (= H5), Q60 (≠ E50), H84 (= H73), E134 (= E123)
6wfiA Methylmalonyl-coa epimerase in complex with 2-nitronate-propionyl-coa (see paper)
38% identity, 98% coverage: 2:125/127 of query aligns to 4:136/144 of 6wfiA
- active site: H7 (= H5), E43 (≠ V39), Q60 (≠ E50), H84 (= H73), E134 (= E123)
- binding cobalt (ii) ion: H7 (= H5), Q60 (≠ E50), H84 (= H73), E134 (= E123)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: H7 (= H5), Q39 (≠ D35), Q60 (≠ E50), A70 (≠ T59), K73 (≠ Q62), W74 (≠ Y63), H83 (= H72), H84 (= H73), L107 (≠ I96), G114 (= G103), S115 (≠ A104), I120 (≠ V109), F122 (= F111), P125 (= P114), L132 (= L121), E134 (= E123)
6wf7A Methylmalonyl-coa epimerase in complex with methylmalonyl-coa and nh4+ (see paper)
38% identity, 98% coverage: 2:125/127 of query aligns to 4:136/144 of 6wf7A
- active site: H7 (= H5), E43 (≠ V39), Q60 (≠ E50), H84 (= H73), E134 (= E123)
- binding (S)-Methylmalonyl-Coenzyme A: Q39 (≠ D35), E43 (≠ V39), Q60 (≠ E50), A70 (≠ T59), W74 (≠ Y63), H83 (= H72), H84 (= H73), L107 (≠ I96), G114 (= G103), S115 (≠ A104), F122 (= F111), P125 (= P114), K126 (= K115), L132 (= L121), E134 (= E123)
- binding methylmalonyl-coenzyme a: Q39 (≠ D35), Q60 (≠ E50), A70 (≠ T59), W74 (≠ Y63), H83 (= H72), H84 (= H73), L107 (≠ I96), G114 (= G103), S115 (≠ A104), I120 (≠ V109), F122 (= F111), P125 (= P114), K126 (= K115), L132 (= L121), E134 (= E123)
6wfhA Streptomyces coelicolor methylmalonyl-coa epimerase substrate complex (see paper)
38% identity, 98% coverage: 2:125/127 of query aligns to 4:136/139 of 6wfhA
- active site: H7 (= H5), E43 (≠ V39), Q60 (≠ E50), H84 (= H73), E134 (= E123)
- binding cobalt (ii) ion: H7 (= H5), Q60 (≠ E50), H84 (= H73), E134 (= E123)
- binding (3S,5R,9R,19E)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9,19-tetrahydroxy-8,8,20-trimethyl-10,14-dioxo-2,4,6-trioxa-18-thia-11,15-diaza-3,5-diphosphahenicos-19-en-21-oic acid 3,5-dioxide (non-preferred name): H7 (= H5), Q39 (≠ D35), Q60 (≠ E50), A70 (≠ T59), K73 (≠ Q62), W74 (≠ Y63), H83 (= H72), H84 (= H73), L107 (≠ I96), G114 (= G103), S115 (≠ A104), F122 (= F111), P125 (= P114), K126 (= K115), L132 (= L121), E134 (= E123)
6xbtA Streptomyces coelicolor methylmalonyl-coa epimerase (q60a) in complex with 2-nitronate-propionyl-coa
38% identity, 98% coverage: 2:125/127 of query aligns to 4:136/140 of 6xbtA
- active site: H7 (= H5), E43 (≠ V39), A60 (≠ E50), H84 (= H73), E134 (= E123)
- binding cobalt (ii) ion: H7 (= H5), H84 (= H73), E134 (= E123)
- binding coenzyme a: Q39 (≠ D35), A70 (≠ T59), K73 (≠ Q62), W74 (≠ Y63), K77 (≠ A66), H83 (= H72), L107 (≠ I96), F122 (= F111), P125 (= P114), K126 (= K115), L132 (= L121)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: H7 (= H5), Q39 (≠ D35), A70 (≠ T59), K73 (≠ Q62), W74 (≠ Y63), H83 (= H72), H84 (= H73), L107 (≠ I96), G114 (= G103), S115 (≠ A104), P125 (= P114), K126 (= K115), L132 (= L121), E134 (= E123)
Q96PE7 Methylmalonyl-CoA epimerase, mitochondrial; DL-methylmalonyl-CoA racemase; EC 5.1.99.1 from Homo sapiens (Human) (see paper)
35% identity, 97% coverage: 2:124/127 of query aligns to 47:173/176 of Q96PE7
- H50 (= H5) binding Co(2+)
- R104 (≠ E56) to L: in dbSNP:rs6748672
- H122 (= H73) binding Co(2+)
- E172 (= E123) binding Co(2+)
6qh4C Crystal structure of human methylmalonyl-coa epimerase (mcee) p.Arg143cys variant
34% identity, 97% coverage: 2:124/127 of query aligns to 11:135/138 of 6qh4C
Query Sequence
>WP_076581962.1 NCBI__GCF_001971705.1:WP_076581962.1
MHFEHAGIATEDAQELAELYSDLFGLAVAHEEEFDGMRVVFLECGDGYFELLEPFEDGTI
AQYLEANGSGIHHLALATEDIEAALETAREHDVSLIDEEPRPGAWGHSVAFLHPKDTGGI
LLELVEH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory