SitesBLAST
Comparing WP_077277352.1 NCBI__GCF_002000365.1:WP_077277352.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
34% identity, 88% coverage: 2:283/319 of query aligns to 3:280/303 of 6plgA
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
34% identity, 88% coverage: 2:283/319 of query aligns to 2:279/297 of 6rj3A
7dkmA Phgdh covalently linked to oridonin (see paper)
34% identity, 88% coverage: 2:283/319 of query aligns to 4:281/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ K78), A102 (= A105), G148 (= G149), R151 (≠ K152), I152 (= I153), Y170 (≠ W171), D171 (≠ G172), P172 (≠ R173), I173 (≠ E174), H202 (= H204), T203 (≠ L205), P204 (≠ A206), T209 (= T211), C230 (≠ T232), A231 (≠ S233), R232 (= R234), H279 (= H281), G281 (= G283)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: C14 (= C12), K17 (≠ T15), I18 (≠ L16)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 293
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
34% identity, 88% coverage: 2:283/319 of query aligns to 3:280/301 of 6rj5A
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
34% identity, 88% coverage: 2:283/319 of query aligns to 3:280/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ F148), G147 (= G149), L148 (≠ Y150), G149 (= G151), R150 (≠ K152), I151 (= I153), G152 (= G154), D170 (≠ G172), H201 (= H204), T202 (≠ L205), P203 (≠ A206)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
34% identity, 88% coverage: 2:283/319 of query aligns to 3:280/302 of 6rihA
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
34% identity, 88% coverage: 2:283/319 of query aligns to 2:279/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ A101), A100 (= A105), R149 (≠ K152), I150 (= I153), Y168 (≠ W171), D169 (≠ G172), P170 (≠ R173), I171 (≠ E174), H200 (= H204), T201 (≠ L205), P202 (≠ A206), T207 (= T211), C228 (≠ T232), A229 (≠ S233), R230 (= R234), H277 (= H281), G279 (= G283)
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
34% identity, 88% coverage: 2:283/319 of query aligns to 4:281/305 of 6plfA
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
34% identity, 88% coverage: 2:283/319 of query aligns to 8:285/533 of O43175
- T78 (≠ K78) binding
- R135 (≠ T134) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ KI 152:153) binding
- D175 (≠ G172) binding
- T207 (≠ L205) binding
- CAR 234:236 (≠ TSR 232:234) binding
- D260 (= D258) binding
- V261 (= V259) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 283:286 binding
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
34% identity, 88% coverage: 3:283/319 of query aligns to 1:277/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G151), I148 (= I153), Y166 (≠ W171), D167 (≠ G172), P168 (≠ R173), I169 (≠ E174), I170 (≠ G175), H198 (= H204), T199 (≠ L205), L208 (≠ I214), R228 (= R234)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
33% identity, 88% coverage: 38:319/319 of query aligns to 37:327/334 of 5aovA
- active site: L100 (vs. gap), R241 (= R234), D265 (= D258), E270 (= E263), H288 (= H281)
- binding glyoxylic acid: M52 (≠ L52), L53 (≠ I53), L53 (≠ I53), Y74 (≠ T76), A75 (≠ G77), V76 (≠ K78), G77 (= G79), R241 (= R234), H288 (= H281)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ K78), T104 (≠ A105), F158 (≠ Y150), G159 (= G151), R160 (≠ K152), I161 (= I153), S180 (≠ G172), R181 (= R173), A211 (≠ H204), V212 (≠ L205), P213 (≠ A206), T218 (= T211), I239 (≠ T232), A240 (≠ S233), R241 (= R234), H288 (= H281), G290 (= G283)
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
33% identity, 88% coverage: 2:283/319 of query aligns to 2:271/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ K152), Y160 (≠ W171), D161 (≠ G172), P162 (≠ R173), I164 (≠ G175), L179 (≠ Q191), T193 (≠ L205), P194 (≠ A206), S198 (≠ G210), L202 (≠ I214)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
33% identity, 88% coverage: 38:319/319 of query aligns to 36:326/332 of 6biiA
- active site: L99 (≠ A105), R240 (= R234), D264 (= D258), E269 (= E263), H287 (= H281)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ K78), T103 (= T109), G156 (= G149), F157 (≠ Y150), G158 (= G151), R159 (≠ K152), I160 (= I153), A179 (≠ G172), R180 (= R173), S181 (≠ E174), K183 (≠ S176), V211 (≠ L205), P212 (≠ A206), E216 (≠ G210), T217 (= T211), V238 (≠ T232), A239 (≠ S233), R240 (= R234), D264 (= D258), H287 (= H281), G289 (= G283)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
36% identity, 82% coverage: 22:283/319 of query aligns to 17:280/304 of 1wwkA
- active site: S96 (≠ A105), R230 (= R234), D254 (= D258), E259 (= E263), H278 (= H281)
- binding nicotinamide-adenine-dinucleotide: V100 (vs. gap), G146 (= G149), F147 (≠ Y150), G148 (= G151), R149 (≠ K152), I150 (= I153), Y168 (≠ W171), D169 (≠ G172), P170 (≠ R173), V201 (≠ L205), P202 (≠ A206), T207 (= T211), T228 (= T232), S229 (= S233), D254 (= D258), H278 (= H281), G280 (= G283)
2eklA Structure of st1218 protein from sulfolobus tokodaii
32% identity, 79% coverage: 50:302/319 of query aligns to 48:303/312 of 2eklA
- active site: S100 (≠ P102), R232 (= R234), D256 (= D258), E261 (= E263), H282 (= H281)
- binding nicotinamide-adenine-dinucleotide: I76 (≠ K78), S100 (≠ P102), G148 (= G149), G150 (= G151), R151 (≠ K152), I152 (= I153), Y170 (≠ W171), D171 (≠ G172), I172 (≠ R173), L173 (≠ E174), H202 (= H204), V203 (≠ L205), T204 (≠ A206), I212 (= I214), T230 (= T232), S231 (= S233), D256 (= D258), G284 (= G283)
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
36% identity, 82% coverage: 21:283/319 of query aligns to 10:280/525 of 3ddnB
Sites not aligning to the query:
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
36% identity, 82% coverage: 21:283/319 of query aligns to 9:279/526 of 3dc2A
Sites not aligning to the query:
2p9eA Crystal structure of g336v mutant of e.Coli phosphoglycerate dehydrogenase (see paper)
33% identity, 80% coverage: 36:291/319 of query aligns to 39:298/406 of 2p9eA
- active site: N104 (vs. gap), R236 (= R234), D260 (= D258), E265 (= E263), H288 (= H281)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G156 (= G151), H157 (≠ K152), I158 (= I153), Y176 (≠ W171), D177 (≠ G172), I178 (≠ R173), H206 (= H204), V207 (≠ L205), P208 (≠ A206), S212 (≠ G210), A234 (≠ T232), S235 (= S233), R236 (= R234), H288 (= H281), G290 (= G283)
P0A9T0 D-3-phosphoglycerate dehydrogenase; PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 80% coverage: 36:291/319 of query aligns to 43:302/410 of P0A9T0
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ybaA The active form of phosphoglycerate dehydrogenase (see paper)
33% identity, 80% coverage: 36:291/319 of query aligns to 39:298/406 of 1ybaA
- active site: N104 (vs. gap), R236 (= R234), D260 (= D258), E265 (= E263), H288 (= H281)
- binding 2-oxoglutaric acid: R56 (= R54), S57 (≠ E55), C79 (≠ G77), I80 (≠ K78)
- binding nicotinamide-adenine-dinucleotide: I80 (≠ K78), F102 (= F103), V108 (≠ A105), G154 (= G149), G156 (= G151), H157 (≠ K152), I158 (= I153), Y176 (≠ W171), D177 (≠ G172), I178 (≠ R173), K181 (≠ S176), H206 (= H204), V207 (≠ L205), P208 (≠ A206), A234 (≠ T232), S235 (= S233), R236 (= R234), H288 (= H281), G290 (= G283)
- binding phosphate ion: G81 (= G79), N83 (≠ A81)
Query Sequence
>WP_077277352.1 NCBI__GCF_002000365.1:WP_077277352.1
MKIVIPDDYQDCVRTLACFARLADHEVTVYNDTVRDVETLAERFRDAEALVLIRERTPIT
DELLERLPRLRLISQTGKGIAHVDLEACTRRGVAVAVGTGAPFAAAELTWGLIIAAMRHI
PAEVAAMKAGKWQTRLGTGLRGRTLGIFGYGKIGSLVAHYGRAFAMRVLVWGREGSLERA
AMVGFDTAKSQEDLFARSDVLSLHLALNEGTRGIVTADHLAAMKPTALLVNTSRAELIAE
GALVDALKAGRPGMAAVDVYENEPVRDHPLLHLDNALCTPHLGFVERDGYELYFGAAFDN
LLAFADGSPRNLANPETVS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory