Comparing WP_077278205.1 NCBI__GCF_002000365.1:WP_077278205.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
40% identity, 94% coverage: 23:424/427 of query aligns to 9:409/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
40% identity, 94% coverage: 23:424/427 of query aligns to 9:409/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
34% identity, 96% coverage: 11:420/427 of query aligns to 3:408/412 of 4jbeB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
24% identity, 74% coverage: 94:408/427 of query aligns to 72:425/455 of 5j7iC
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
24% identity, 74% coverage: 94:408/427 of query aligns to 73:426/456 of 5j7iB
4yweA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
31% identity, 43% coverage: 110:291/427 of query aligns to 122:303/476 of 4yweA
Sites not aligning to the query:
>WP_077278205.1 NCBI__GCF_002000365.1:WP_077278205.1
MNAVVENKAGEIEGQMQETGRRARVASRALARADTGVKNAALLAIAQIIEDRADALTAEN
RKDLEAGEQNGLEAALLDRLAFTPERIAVMAEGLRQIAALPDPVGAISDLNYRPSGIQVG
RMRVPLGVIGIIYESRPNVTVDAAGLCLKSGNACILRGGSEAFHSNRALADGIRAGLEQA
GLPGDAVQVVGTTDRAAVGALLRMKEHVDVIVPRGGKGLIARVSEESLIPVIKHLDGVCH
VYVDDGADPGKALKVAVNAKTQRYGTCNTMETLLVSRHVAAEMLPVLADAFVEKGVELRG
CESTRAIVSGIAEATEQDWTEEYLAPVLAIRVVDGLDAAIEHINTYGSHHTDSIVTEDYG
RARRFLREVDSSSVMVNASTRFADGFEYGLGAEIGISTDKLHARGPVGLEGLTTLKYIVL
GDGHVRE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory