Comparing WP_078428648.1 NCBI__GCF_002019605.1:WP_078428648.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
P22106 Asparagine synthetase B [glutamine-hydrolyzing]; AS-B; EC 6.3.5.4 from Escherichia coli (strain K12) (see 2 papers)
26% identity, 90% coverage: 1:556/615 of query aligns to 1:467/554 of P22106
1ct9A Crystal structure of asparagine synthetase b from escherichia coli (see paper)
26% identity, 87% coverage: 2:534/615 of query aligns to 1:433/497 of 1ct9A
P78753 Probable asparagine synthetase [glutamine-hydrolyzing]; Glutamine-dependent asparagine synthetase; EC 6.3.5.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 89% coverage: 1:547/615 of query aligns to 1:481/557 of P78753
Sites not aligning to the query:
P08243 Asparagine synthetase [glutamine-hydrolyzing]; Cell cycle control protein TS11; Glutamine-dependent asparagine synthetase; EC 6.3.5.4 from Homo sapiens (Human) (see 7 papers)
27% identity, 64% coverage: 1:393/615 of query aligns to 1:379/561 of P08243
Sites not aligning to the query:
6gq3A Human asparagine synthetase (asns) in complex with 6-diazo-5-oxo-l- norleucine (don) at 1.85 a resolution (see paper)
26% identity, 60% coverage: 25:393/615 of query aligns to 20:366/509 of 6gq3A
Sites not aligning to the query:
1jgtB Crystal structure of beta-lactam synthetase (see paper)
28% identity, 45% coverage: 73:346/615 of query aligns to 69:310/500 of 1jgtB
Sites not aligning to the query:
1mbzA Beta-lactam synthetase with trapped intermediate (see paper)
27% identity, 45% coverage: 73:346/615 of query aligns to 65:302/496 of 1mbzA
Sites not aligning to the query:
1mb9A Beta-lactam synthetase complexed with atp (see paper)
26% identity, 46% coverage: 63:346/615 of query aligns to 56:301/485 of 1mb9A
Sites not aligning to the query:
1mc1A Beta-lactam synthetase with product (dgpc), amp and ppi (see paper)
26% identity, 45% coverage: 73:346/615 of query aligns to 61:297/491 of 1mc1A
Sites not aligning to the query:
P00497 Amidophosphoribosyltransferase; ATase; Glutamine phosphoribosylpyrophosphate amidotransferase; GPATase; EC 2.4.2.14 from Bacillus subtilis (strain 168) (see 5 papers)
30% identity, 20% coverage: 44:167/615 of query aligns to 77:209/476 of P00497
Sites not aligning to the query:
1gph1 Structure of the allosteric regulatory enzyme of purine biosynthesis (see paper)
30% identity, 20% coverage: 44:167/615 of query aligns to 66:198/465 of 1gph1
Sites not aligning to the query:
Q9STG9 Amidophosphoribosyltransferase 2, chloroplastic; AtATase2; AtPURF2; PRPP2; Glutamine phosphoribosylpyrophosphate amidotransferase 2; AtGPRAT2; Protein CHLOROPLAST IMPORT APPARATUS 1; Protein DIFFERENTIAL DEVELOPMENT OF VASCULAR ASSOCIATED CELLS; EC 2.4.2.14 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 28% coverage: 33:202/615 of query aligns to 150:328/561 of Q9STG9
Sites not aligning to the query:
1ao0A Glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. Subtilis complexed with adp and gmp (see paper)
30% identity, 20% coverage: 44:167/615 of query aligns to 66:194/455 of 1ao0A
Sites not aligning to the query:
6lbpA Structure of the glutamine phosphoribosylpyrophosphate amidotransferase from arabidopsis thaliana (see paper)
28% identity, 28% coverage: 33:202/615 of query aligns to 64:242/460 of 6lbpA
Sites not aligning to the query:
Q27601 Amidophosphoribosyltransferase; ATase; Glutamine phosphoribosylpyrophosphate amidotransferase; GPAT; Phosphoribosylamidotransferase; PRAT; EC 2.4.2.14 from Drosophila melanogaster (Fruit fly) (see paper)
36% identity, 11% coverage: 45:109/615 of query aligns to 129:195/546 of Q27601
Sites not aligning to the query:
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
24% identity, 20% coverage: 9:133/615 of query aligns to 48:192/663 of 6r4eA
Sites not aligning to the query:
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
24% identity, 20% coverage: 9:133/615 of query aligns to 48:192/660 of 6svmA
Sites not aligning to the query:
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
24% identity, 20% coverage: 9:133/615 of query aligns to 48:192/652 of 6r4gA
Sites not aligning to the query:
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
24% identity, 20% coverage: 9:133/615 of query aligns to 49:193/699 of Q06210
Sites not aligning to the query:
>WP_078428648.1 NCBI__GCF_002019605.1:WP_078428648.1
MCGITGWIDWKHNMMKEQTEVEKMAKTLSRRGPDDINIWNSHHAALGHTRLIVVDPEGGI
QPMTRKKGNRSYTICYNGELYNTEDLRKELLQRGYTFKGHSDTEVLLTSYIEWGFHCLEK
LNGIFAFSIWSEHDQSLILARDRLGVKPLFYSVQNGRLLFGSEIKALLAHRDMSPTIDET
GLSEVLGLGPSRTPGNGVFSNIEELRPAHAMLYDRNGAKISRYWKLKSKEHVDSLDETAE
KVRWLLTDTVERQLVADVPICTFLSGGIDSSALTALAANVYERDNKGILRTYSVDYAEND
KYFKANDFQPNADGPWIKKVSSEFRTLHTNHVISMKELAGYLKKAVEVRDLPGMADIDSS
LLWFCEKIKEDVTVGLSGECADEIFGGYPWFHKPEVMNLNGFPWMRSTQEREALLQDKWK
NKLKLQSYVHERYKETIGATPRFDEDTKDEARRREISYLNIIWFMTTLLDRKDRMSMGAS
LEVRVPFADHRLVEYVWNIPWEMKRVNGLEKGILRKALEGILPDDVLYRKKSPYPKTHNP
HYTNAVKAEMLNILKENDSPLFDLIDRTKMKEIAESGGASFKTPWFGQLMTGPQLIAHFI
QMDHWLKHYNVEIKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory