Comparing WP_078428931.1 NCBI__GCF_002019605.1:WP_078428931.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7f4cA The crystal structure of the immature holo-enzyme of homoserine dehydrogenase complexed with NADP and 1,4-butandiol from the hyperthermophilic archaeon sulfurisphaera tokodaii. (see paper)
35% identity, 99% coverage: 3:345/345 of query aligns to 2:300/300 of 7f4cA
5x9dA Crystal structure of homoserine dehydrogenase in complex with l- cysteine and NAD (see paper)
35% identity, 99% coverage: 3:345/345 of query aligns to 2:302/302 of 5x9dA
4pg7A Crystal structure of s. Aureus homoserine dehydrogenase at ph7.5 (see paper)
36% identity, 99% coverage: 1:340/345 of query aligns to 2:306/402 of 4pg7A
Sites not aligning to the query:
6dzsA Mycobacterial homoserine dehydrogenase thra in complex with NADP
39% identity, 75% coverage: 86:345/345 of query aligns to 65:326/431 of 6dzsA
Sites not aligning to the query:
Q5F8J4 NAD(+)-dependent homoserine dehydrogenase; NAD(+)-dependent HSD; NgHSD; EC 1.1.1.3 from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) (see paper)
36% identity, 75% coverage: 83:342/345 of query aligns to 62:318/435 of Q5F8J4
Sites not aligning to the query:
6a0sA Homoserine dehydrogenase from thermus thermophilus hb8 complexed with hse and NADPH (see paper)
35% identity, 87% coverage: 3:302/345 of query aligns to 5:269/331 of 6a0sA
Sites not aligning to the query:
2ejwA Homoserine dehydrogenase from thermus thermophilus hb8
35% identity, 87% coverage: 3:302/345 of query aligns to 5:269/331 of 2ejwA
6a0tB Homoserine dehydrogenase k99a mutant from thermus thermophilus hb8 complexed with hse and NADP+ (see paper)
35% identity, 87% coverage: 3:302/345 of query aligns to 5:269/332 of 6a0tB
Sites not aligning to the query:
4xb2A Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with NADPH (see paper)
31% identity, 97% coverage: 4:338/345 of query aligns to 5:309/319 of 4xb2A
4xb1A Hyperthermophilic archaeal homoserine dehydrogenase in complex with NADPH (see paper)
31% identity, 97% coverage: 4:338/345 of query aligns to 5:309/319 of 4xb1A
3ingA Crystal structure of homoserine dehydrogenase (np_394635.1) from thermoplasma acidophilum at 1.95 a resolution
28% identity, 73% coverage: 3:253/345 of query aligns to 4:238/319 of 3ingA
Sites not aligning to the query:
3jsaA Homoserine dehydrogenase from thermoplasma volcanium complexed with NAD
26% identity, 97% coverage: 4:338/345 of query aligns to 6:317/321 of 3jsaA
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 97% coverage: 7:340/345 of query aligns to 558:908/916 of O81852
Sites not aligning to the query:
O94671 Probable homoserine dehydrogenase; HDH; EC 1.1.1.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
22% identity, 57% coverage: 115:309/345 of query aligns to 123:331/376 of O94671
1tveA Homoserine dehydrogenase in complex with 4-(4-hydroxy-3- isopropylphenylthio)-2-isopropylphenol (see paper)
23% identity, 46% coverage: 153:311/345 of query aligns to 142:324/358 of 1tveA
Sites not aligning to the query:
1q7gA Homoserine dehydrogenase in complex with suicide inhibitor complex NAD-5-hydroxy-4-oxonorvaline (see paper)
23% identity, 46% coverage: 153:311/345 of query aligns to 142:324/358 of 1q7gA
Sites not aligning to the query:
1ebuD Homoserine dehydrogenase complex with NAD analogue and l-homoserine (see paper)
23% identity, 46% coverage: 153:311/345 of query aligns to 142:324/358 of 1ebuD
Sites not aligning to the query:
1ebfA Homoserine dehydrogenase from s. Cerevisiae complex with NAD+ (see paper)
23% identity, 46% coverage: 153:311/345 of query aligns to 142:324/358 of 1ebfA
Sites not aligning to the query:
P31116 Homoserine dehydrogenase; HDH; EC 1.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 46% coverage: 153:311/345 of query aligns to 143:325/359 of P31116
Sites not aligning to the query:
8owmC Crystal structure of glutamate dehydrogenase 2 from arabidopsis thaliana binding ca, NAD and 2,2-dihydroxyglutarate (see paper)
36% identity, 23% coverage: 4:81/345 of query aligns to 211:277/413 of 8owmC
Sites not aligning to the query:
>WP_078428931.1 NCBI__GCF_002019605.1:WP_078428931.1
MQKLALLGFGTVGQGLAEILLQKKDALKAETGWEGKVVAISDMIKGSIYDPEGIDIEKAL
AIVKKTGTLDDYPESEGLIRDLDSFETIEQTNADTIVEVTFTDVKTGQPAIDHCKTAFAA
GKHVVMSNKGPVALAYKELSQLANQHGVRWGFEGTVMSGTPALRMPLTALAGNDINEISG
ILNGTTNYMLLRMEEGLSYEEALTEAQNKGFAEADPTSDVEGYDARYKIVILANTVMNTT
LKVDDVACDGITQLTPYDIKKAKAQGKRWKLIARVRKEHGVVKASVQPEMMDETHPLAQV
QGVINAVSFECDLAGTITLSGPGAGRTETGYSLLIDLLNIYRNHL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory