Comparing WP_078429410.1 NCBI__GCF_002019605.1:WP_078429410.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
3w45A Crystal structure of rsbx in complex with cobalt in space group p1 (see paper)
34% identity, 100% coverage: 1:199/200 of query aligns to 1:198/199 of 3w45A
3w42A Crystal structure of rsbx in complex with manganese in space group p1 (see paper)
34% identity, 100% coverage: 1:199/200 of query aligns to 1:198/199 of 3w42A
3w40A Crystal structure of rsbx in complex with magnesium in space group p1 (see paper)
34% identity, 100% coverage: 1:199/200 of query aligns to 1:198/199 of 3w40A
3zt9A The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling (see paper)
26% identity, 96% coverage: 8:198/200 of query aligns to 1:192/192 of 3zt9A
>WP_078429410.1 NCBI__GCF_002019605.1:WP_078429410.1
MIEFLLKEYVNIATYQKPKEGNSLNGDSFVVLEVDGYIVCAVSDGLGSGEHAHSSSVSVM
NVIKQNHEKSVKEIIQRCNETLVAKRGVVLTVVKFDCKKKNVHYSSIGNIGFLFYSANGQ
MIRPIPNRGFLSGRKVDVKTEQFPYDSGSTFVIFSDGVKLSSMKRENLIDLCSEENAKQI
IQKHVQVTEDDITILIGQLH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory