Comparing WP_078429461.1 NCBI__GCF_002019605.1:WP_078429461.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
44% identity, 78% coverage: 6:176/220 of query aligns to 79:249/250 of 4hzdA
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
42% identity, 83% coverage: 3:185/220 of query aligns to 72:255/258 of 8i04A
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
41% identity, 83% coverage: 3:185/220 of query aligns to 76:259/262 of 1t3dA
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
43% identity, 77% coverage: 3:171/220 of query aligns to 76:244/244 of 8i06A
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
43% identity, 77% coverage: 3:171/220 of query aligns to 75:243/246 of 8i09A
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
40% identity, 83% coverage: 3:185/220 of query aligns to 77:259/261 of 6wyeA
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
42% identity, 77% coverage: 3:171/220 of query aligns to 75:243/243 of 7ra4A
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
44% identity, 78% coverage: 4:174/220 of query aligns to 73:243/257 of 1ssqD
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
40% identity, 77% coverage: 3:171/220 of query aligns to 72:240/258 of 4h7oA
Sites not aligning to the query:
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
45% identity, 74% coverage: 10:171/220 of query aligns to 82:243/243 of 4n69A
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
44% identity, 73% coverage: 11:171/220 of query aligns to 87:247/272 of 3gvdI
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
41% identity, 76% coverage: 4:171/220 of query aligns to 53:233/233 of 4n6bA
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
42% identity, 72% coverage: 6:163/220 of query aligns to 101:258/280 of 7bw9A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
43% identity, 72% coverage: 6:163/220 of query aligns to 101:266/267 of 3q1xA
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
43% identity, 72% coverage: 6:163/220 of query aligns to 103:268/270 of 3p47A
1sstA Serine acetyltransferase- complex with coa (see paper)
40% identity, 77% coverage: 3:171/220 of query aligns to 72:233/233 of 1sstA
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
34% identity, 50% coverage: 65:173/220 of query aligns to 69:183/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
34% identity, 50% coverage: 65:173/220 of query aligns to 69:183/201 of 1kruA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 50% coverage: 65:173/220 of query aligns to 70:184/203 of P07464
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
34% identity, 50% coverage: 65:173/220 of query aligns to 69:183/200 of 1krrA
>WP_078429461.1 NCBI__GCF_002019605.1:WP_078429461.1
MGKVFQTLKSDIDVVFEQDPAARSRLEVIFTYSGVHAIWSHRFAHWFWKRKLYFFARSIS
QVSRFFTGIEIHPGAKIGQRLFIDHGMGVVIGETCEIGDNVTIYQGVTLGGTGKEKGKRH
PTVEDNVLIATGAKVLGSFTIGENARIGAGSVVLKEVPKNSTVVGIPGKVVLQDGVKVQG
NLDHHNLPDPISDKFRELEDQIDALRTEIEYYKRQTTVKE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory