SitesBLAST
Comparing WP_078717840.1 NCBI__GCF_900167125.1:WP_078717840.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
39% identity, 99% coverage: 4:267/268 of query aligns to 9:267/267 of 2hk9B
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V67 (≠ I62), G130 (= G124), G133 (= G127), A134 (= A128), N153 (= N148), R154 (= R149), T155 (≠ N150), K158 (= K153), T188 (= T183), S189 (≠ P184), V190 (≠ L185), I214 (≠ L211), M238 (= M237), L239 (≠ F238)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (= S14), S21 (= S16), N64 (≠ S59), T66 (= T61), K70 (= K65), N91 (= N86), D106 (= D102), Y216 (= Y213), L239 (≠ F238), Q242 (= Q241)
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
39% identity, 99% coverage: 4:267/268 of query aligns to 9:267/269 of 2hk9A
- binding 2'-monophosphoadenosine-5'-diphosphate: V67 (≠ I62), G132 (= G126), G133 (= G127), A134 (= A128), N153 (= N148), R154 (= R149), T155 (≠ N150), T188 (= T183), S189 (≠ P184), V190 (≠ L185)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (= S14), S21 (= S16), N64 (≠ S59), K70 (= K65), N91 (= N86), D106 (= D102), Y216 (= Y213), L239 (≠ F238), Q242 (= Q241)
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
39% identity, 99% coverage: 4:267/268 of query aligns to 9:267/269 of O67049
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
33% identity, 99% coverage: 3:267/268 of query aligns to 2:265/269 of Q5HNV1
- SLS 13:15 (= SLS 14:16) binding
- T60 (= T61) binding
- N85 (= N86) binding
- D100 (= D102) binding
- Y211 (= Y213) Plays a major role in the catalytic process and a minor role in the substrate binding; mutation to F: Leads to a 345-fold decrease in the catalytic efficiency and a 3-fold decrease in the affinity binding for shikimate.
- Q239 (= Q241) binding
2cy0A Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP (see paper)
42% identity, 100% coverage: 1:268/268 of query aligns to 1:262/262 of 2cy0A
- active site: K64 (= K65), D100 (= D102)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G123 (= G124), G126 (= G127), A127 (= A128), N146 (= N148), R147 (= R149), T148 (≠ N150), R151 (≠ K153), T179 (= T183), R180 (≠ P184), V181 (≠ L185), L205 (= L211), L232 (≠ F238)
2ev9B Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP(h) and shikimate (see paper)
42% identity, 100% coverage: 1:268/268 of query aligns to 1:262/263 of 2ev9B
- active site: K64 (= K65), D100 (= D102)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S14 (= S14), S16 (= S16), N58 (≠ S59), T60 (= T61), K64 (= K65), N85 (= N86), D100 (= D102), Q235 (= Q241)
Q5SJF8 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
42% identity, 100% coverage: 1:268/268 of query aligns to 1:262/263 of Q5SJF8
Q58484 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
35% identity, 98% coverage: 5:267/268 of query aligns to 10:280/282 of Q58484
1nvtB Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
35% identity, 98% coverage: 5:267/268 of query aligns to 15:285/287 of 1nvtB
- active site: K75 (= K65), D111 (= D102)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I72 (= I62), G135 (= G126), G137 (≠ A128), G138 (≠ A129), A139 (≠ R130), N157 (= N148), R158 (= R149), T159 (≠ N150), K162 (= K153), A200 (= A182), T201 (= T183), P202 (= P184), I203 (≠ L185), M205 (= M187), L229 (= L211), Y231 (= Y213), M255 (= M237), L256 (≠ F238)
- binding zinc ion: E22 (≠ G12), H23 (= H13)
1nvtA Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
35% identity, 98% coverage: 5:267/268 of query aligns to 15:285/287 of 1nvtA
- active site: K75 (= K65), D111 (= D102)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G135 (= G126), A139 (≠ R130), N157 (= N148), R158 (= R149), T159 (≠ N150), K162 (= K153), A200 (= A182), T201 (= T183), P202 (= P184), I203 (≠ L185), M205 (= M187), L229 (= L211), Y231 (= Y213), G252 (= G234), M255 (= M237), L256 (≠ F238)
3dooA Crystal structure of shikimate dehydrogenase from staphylococcus epidermidis complexed with shikimate (see paper)
31% identity, 99% coverage: 3:267/268 of query aligns to 2:256/258 of 3dooA
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S13 (= S14), S15 (= S16), N58 (≠ S59), T60 (= T61), K64 (= K65), N85 (= N86), D100 (= D102), F227 (= F238), Q230 (= Q241)
3tozA 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with NAD.
34% identity, 98% coverage: 2:264/268 of query aligns to 14:291/291 of 3tozA
- binding nicotinamide-adenine-dinucleotide: G137 (= G124), A138 (= A125), G139 (= G126), G140 (= G127), A141 (= A128), N161 (= N148), R162 (= R149), D164 (≠ P151), F166 (vs. gap), T210 (= T183), G211 (≠ P184), V212 (≠ L185), M214 (= M187), F217 (≠ Y191), V238 (≠ L211), Y240 (= Y213), G261 (= G234), M264 (= M237), M265 (≠ F238)
Q8Y9N5 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
34% identity, 98% coverage: 2:264/268 of query aligns to 14:291/291 of Q8Y9N5
3tnlA 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and NAD.
34% identity, 98% coverage: 2:264/268 of query aligns to 11:288/288 of 3tnlA
- binding nicotinamide-adenine-dinucleotide: M71 (≠ I62), G134 (= G124), A135 (= A125), G136 (= G126), G137 (= G127), A138 (= A128), N158 (= N148), R159 (= R149), D161 (≠ P151), F163 (vs. gap), T207 (= T183), V209 (≠ L185), M211 (= M187), F214 (≠ Y191), V235 (≠ L211), Y237 (= Y213), M261 (= M237), M262 (≠ F238)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S14), S25 (= S16), N68 (≠ S59), S70 (≠ T61), K74 (= K65), N95 (= N86), D110 (= D102), Q265 (= Q241)
P44774 Shikimate dehydrogenase-like protein HI_0607; SDH-L; EC 1.1.1.25 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see paper)
31% identity, 89% coverage: 14:252/268 of query aligns to 18:253/271 of P44774
- K67 (= K65) mutation K->A,H,N: Loss of activity.
- D103 (= D102) mutation D->A,N: Loss of activity.
1npdB X-ray structure of shikimate dehydrogenase complexed with NAD+ from e.Coli (ydib) northeast structural genomics research consortium (nesg) target er24 (see paper)
30% identity, 94% coverage: 2:254/268 of query aligns to 8:275/288 of 1npdB
- binding nicotinamide-adenine-dinucleotide: A132 (= A125), G133 (= G126), G134 (= G127), A135 (= A128), N155 (= N148), R156 (= R149), D158 (≠ P151), F160 (= F161), T204 (≠ P190), K205 (≠ Y191), V206 (≠ Q192), M208 (≠ Q194), C232 (≠ L211), M258 (= M237), L259 (≠ F238)
P0A6D5 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Escherichia coli (strain K12) (see 4 papers)
30% identity, 94% coverage: 2:254/268 of query aligns to 8:275/288 of P0A6D5
- S22 (= S16) mutation to A: Kinetically unchanged as compared with the wild-type.
- Y39 (= Y33) mutation to F: Kinetically unchanged as compared with the wild-type.
- S67 (≠ T61) mutation to A: Reduces activity towards quinate about 6-fold, but has a little effect on shikimate conversion.
- K71 (= K65) mutation to A: 3200-fold decrease in the affinity for quinate. 170-fold decrease in the affinity for shikimate.; mutation to G: 10-fold greater reduction in catalytic efficiency is observed with quinate than with shikimate.
- N92 (= N86) mutation to A: Alters protein structure. Loss of activity for both substrates.
- T106 (= T101) mutation to A: 2000-fold decrease in the affinity for quinate. 70-fold decrease in the affinity for shikimate. 10-fold greater reduction in catalytic efficiency is observed with quinate than with shikimate.
- D107 (= D102) mutation to A: Loss of activity towards quinate. 20000-fold decrease in the affinity for shikimate.
- AGGA 132:135 (= AGGA 125:128) binding
- NRRD 155:158 (≠ NRNP 148:151) binding
- K205 (≠ Y191) binding
- CVYN 232:235 (≠ LVYN 211:214) binding
- G255 (= G234) binding
- Q262 (= Q241) mutation to A: 3-fold reduction in catalytic efficiency for both substrates.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1o9bA Quinate/shikimate dehydrogenase ydib complexed with nadh (see paper)
30% identity, 94% coverage: 2:254/268 of query aligns to 2:269/280 of 1o9bA
- binding 1,4-dihydronicotinamide adenine dinucleotide: A126 (= A125), G127 (= G126), G128 (= G127), A129 (= A128), R150 (= R149), F154 (= F161), K199 (≠ Y191), V200 (≠ Q192), M202 (≠ Q194), C226 (≠ L211), Y228 (= Y213), M252 (= M237), L253 (≠ F238)
Q9SQT8 Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic; DHQ-SDH protein; DHQase-SORase; Protein EMBRYO DEFECTIVE 3004; EC 4.2.1.10; EC 1.1.1.25 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 93% coverage: 4:251/268 of query aligns to 326:588/603 of Q9SQT8
- S336 (= S14) binding ; mutation to A: 13-fold decrease in substrate affinity but almost no change in activity.
- S338 (= S16) binding ; mutation to A: 10-fold decrease in activity, and 9-fold decrease in substrate affinity.
- T381 (= T61) binding
- K385 (= K65) binding ; mutation to A: Strongly reduced shikimate dehydrogenase activity, but minor change in substrate affinity.; mutation to N: Strongly reduced shikimate dehydrogenase activity, but no change in substrate affinity.
- N406 (= N86) binding
- D423 (= D102) binding ; mutation to A: Loss of shikimate dehydrogenase activity.; mutation to N: Reduced shikimate dehydrogenase activity, but no change in substrate affinity.
- A461 (= A125) binding
- G463 (= G127) binding
- A464 (= A128) binding
- N483 (= N148) binding
- T485 (≠ N150) binding
- R488 (≠ K153) binding
- M525 (= M187) binding
- A548 (≠ L211) binding
- Y550 (= Y213) binding ; mutation Y->F,A: 100-fold decrease in activity, and 2-fold decrease in substrate affinity.
- G571 (= G234) binding
- Q578 (= Q241) binding
- Q582 (= Q245) binding
Sites not aligning to the query:
- 124 binding
- 126 binding
- 155 binding
- 241 binding
- 279 binding
- 300 binding
- 304 binding
2o7sA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
37% identity, 93% coverage: 4:251/268 of query aligns to 237:476/500 of 2o7sA
- binding 3-dehydroshikimate: I239 (= I6), S247 (= S14), S249 (= S16), T292 (= T61), K296 (= K65), N317 (= N86), D334 (= D102), Y438 (= Y213), Q466 (= Q241), Q470 (= Q245)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I293 (= I62), P294 (= P63), K296 (= K65), D334 (= D102), G354 (= G126), G355 (= G127), A356 (= A128), N374 (= N148), R375 (= R149), T376 (≠ N150), R379 (≠ K153), T409 (= T183), S410 (≠ P184), M411 (≠ L185), A436 (≠ L211), M462 (= M237), F463 (= F238)
Sites not aligning to the query:
Query Sequence
>WP_078717840.1 NCBI__GCF_900167125.1:WP_078717840.1
MEQYGIIGHPLGHSLSPALHNWGFARWSMDAVYDFWDTPPDSLAAFVDRVRAENIRGVSV
TIPHKRTIMPLLDRVSTTARAIGAVNTICWDEHGRLRGTNTDVAGCLEPLRRVIPKPKTA
LVLGAGGAARAAIAALNQLGVEWVGVSNRNPEKADALALEFSIHAVRWDERHKNPCDVLV
NATPLGMSGPYQGQNPWPMKALPQDTTVFDLVYNPLETPLLALAKTCGCGRISGLEMFLH
QGLKQFHIWTGQDLDPDAARERLLQELG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory