Comparing WP_078718028.1 NCBI__GCF_900167125.1:WP_078718028.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
32% identity, 97% coverage: 1:785/806 of query aligns to 3:809/841 of 8g3hA
Sites not aligning to the query:
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
36% identity, 69% coverage: 8:562/806 of query aligns to 10:557/559 of 1q8jA
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
36% identity, 69% coverage: 8:562/806 of query aligns to 10:557/560 of 3bofA
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
28% identity, 96% coverage: 10:780/806 of query aligns to 13:840/1227 of P13009
Sites not aligning to the query:
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
29% identity, 96% coverage: 4:779/806 of query aligns to 14:865/1265 of Q99707
Sites not aligning to the query:
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
27% identity, 70% coverage: 12:574/806 of query aligns to 13:610/611 of 4cczA
7xcnP Crystal structure of the mttb-mttc complex at 2.7 a resolution (see paper)
41% identity, 23% coverage: 618:801/806 of query aligns to 25:213/215 of 7xcnP
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8 (see paper)
33% identity, 25% coverage: 607:804/806 of query aligns to 10:206/507 of 8sseA
Sites not aligning to the query:
2ycjA Methyltransferase bound with methyltetrahydrofolate (see paper)
33% identity, 33% coverage: 308:573/806 of query aligns to 3:268/271 of 2ycjA
2yciX Methyltransferase native (see paper)
33% identity, 33% coverage: 308:573/806 of query aligns to 3:268/271 of 2yciX
2yckX Methyltransferase bound with tetrahydrofolate (see paper)
33% identity, 33% coverage: 308:573/806 of query aligns to 4:269/272 of 2yckX
3ezxA Structure of methanosarcina barkeri monomethylamine corrinoid protein
41% identity, 23% coverage: 603:786/806 of query aligns to 9:193/212 of 3ezxA
Sites not aligning to the query:
4jgiB 1.5 angstrom crystal structure of a novel cobalamin-binding protein from desulfitobacterium hafniense dcb-2 (see paper)
41% identity, 20% coverage: 644:805/806 of query aligns to 49:205/206 of 4jgiB
2i2xB Crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri (see paper)
31% identity, 25% coverage: 601:805/806 of query aligns to 41:242/258 of 2i2xB
Q46EH4 Methanol--corrinoid protein; Methanol:corrinoid methyltransferase 1 subunit of 27 kDa; MT1 subunit 27 kDa from Methanosarcina barkeri (strain Fusaro / DSM 804) (see paper)
31% identity, 25% coverage: 601:805/806 of query aligns to 41:242/258 of Q46EH4
Sites not aligning to the query:
1y80A Structure of a corrinoid (factor iiim)-binding protein from moorella thermoacetica
45% identity, 15% coverage: 688:805/806 of query aligns to 7:125/125 of 1y80A
1bmtA How a protein binds b12: a 3.O angstrom x-ray structure of the b12- binding domains of methionine synthase (see paper)
35% identity, 22% coverage: 603:780/806 of query aligns to 13:190/246 of 1bmtA
Sites not aligning to the query:
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
33% identity, 22% coverage: 603:780/806 of query aligns to 13:190/576 of 3ivaA
Sites not aligning to the query:
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
33% identity, 22% coverage: 603:780/806 of query aligns to 13:190/577 of 3bulA
Sites not aligning to the query:
4djfA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate and ti(iii) citrate reductant (see paper)
29% identity, 32% coverage: 317:574/806 of query aligns to 2:260/262 of 4djfA
>WP_078718028.1 NCBI__GCF_900167125.1:WP_078718028.1
MPDFRKLLKDDQVRFFDGGYGTLLQQRGLPPGMSPELFGLKSPDAVLQVHRDYLAAGAQV
LTTNTFGGSRFKLGPDADVYDLNKAMCTLARKAAGDNAFVAASIGPTGHFCEPLGELTFR
ELVQAYKEQIQGCVDGGADLILGETHFDLAEARAVVIATREVCDLPVAVSMTFEGANSLT
GTTPLHFIDTMQNMGVDMVATNCSAGPEQIADVVRAMLPRLSTPLYVAANAGLPELDENG
NTVFRLGPDDFAKQSTRFFDMGAKFVGGCCGTGPDHIRALAACSREKSWSLPQPEDRAVV
LTSRGEGVPLGKGHPAVLIGERINPTGKKQLIHELQQGEQTEALRLAGEQVDRGAPVLDV
NVGAPMVDETVTLPALVKALTGRFTTPLCLDSSTPGAVAEALWAYPGSPLVNSISGDPGR
MAELGPLCARFGAPFILLPIKGKKLPVTAPERIAIIEQLLDEAESLGVPRRLAVVDGLAL
TVSSKPEAARATLETIRYCTEELGLATTLGLSNVSFGLPARDLLNSTFLSMCLASGLASF
IANPDSARLREALAASEVLLNRDPQATYFINTYSDWKPTGGTGQPGTNSPQQGTGGEPDS
HPLFSAVVKGNKDGITALVQDALDQGNGPFDLVDEHLIPAIMDVGEKYERKEYFLPQLIQ
SAETLQNAFKILNPLMEADSGKQERPCVIMATVEGDIHDIGKNIVCLMLRNHGFNVVDLG
KDVTADRIVQAAAEEGAKLVGLSALMTTTMVRMEDTVRLLREKGLEHVKVMIGGAVVTEA
FAESIGAHGCSTDAVTAVKLAKQLVN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory