Comparing WP_079646942.1 NCBI__GCF_900167915.1:WP_079646942.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q56WD9 3-ketoacyl-CoA thiolase 2, peroxisomal; Acetyl-CoA acyltransferase 2; Beta-ketothiolase 2; Peroxisomal 3-oxoacyl-CoA thiolase 2; Peroxisome defective protein 1; EC 2.3.1.16 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
44% identity, 99% coverage: 3:398/400 of query aligns to 51:437/462 of Q56WD9
P09110 3-ketoacyl-CoA thiolase, peroxisomal; Acetyl-CoA C-myristoyltransferase; Acetyl-CoA acyltransferase; Beta-ketothiolase; Peroxisomal 3-oxoacyl-CoA thiolase; EC 2.3.1.16; EC 2.3.1.155; EC 2.3.1.9 from Homo sapiens (Human) (see 3 papers)
44% identity, 99% coverage: 3:398/400 of query aligns to 37:420/424 of P09110
Sites not aligning to the query:
8gqmA Crystal structure of thiolase complexed with acetyl coenzyme a
41% identity, 99% coverage: 5:398/400 of query aligns to 4:373/377 of 8gqmA
2d3tC Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form v (see paper)
39% identity, 99% coverage: 2:398/400 of query aligns to 5:388/390 of 2d3tC
8oqlC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1 (see paper)
38% identity, 99% coverage: 3:398/400 of query aligns to 3:395/397 of 8oqlC
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W) (see paper)
38% identity, 100% coverage: 1:398/400 of query aligns to 1:390/392 of P45359
8oqmD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-10 (see paper)
38% identity, 99% coverage: 3:398/400 of query aligns to 4:397/399 of 8oqmD
Sites not aligning to the query:
P14611 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
39% identity, 99% coverage: 1:394/400 of query aligns to 1:387/393 of P14611
8oqoC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49 (see paper)
38% identity, 99% coverage: 3:398/400 of query aligns to 3:396/398 of 8oqoC
8pf8C Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72 (see paper)
37% identity, 99% coverage: 3:398/400 of query aligns to 3:400/402 of 8pf8C
8oqsC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83 (see paper)
37% identity, 99% coverage: 3:398/400 of query aligns to 3:400/402 of 8oqsC
8oqpC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76 (see paper)
37% identity, 99% coverage: 3:398/400 of query aligns to 3:400/402 of 8oqpC
4b3iC Crystal structure of mycobacterium tuberculosis fatty acid beta- oxidation complex with coenzymea bound at the hydratase active sites (see paper)
37% identity, 99% coverage: 3:398/400 of query aligns to 3:400/402 of 4b3iC
7o4tD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme with coenzyme a bound at the hydratase, thiolase active sites and possible additional binding site (coa(ech/had)) (see paper)
37% identity, 99% coverage: 3:398/400 of query aligns to 4:401/403 of 7o4tD
O53871 Putative acyltransferase Rv0859; EC 2.3.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 99% coverage: 3:398/400 of query aligns to 4:401/403 of O53871
8opyD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-b-dnq (see paper)
38% identity, 99% coverage: 3:398/400 of query aligns to 4:399/401 of 8opyD
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
38% identity, 100% coverage: 1:398/400 of query aligns to 1:390/392 of 4xl4A
8opuC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1) (see paper)
37% identity, 99% coverage: 3:398/400 of query aligns to 3:397/399 of 8opuC
4o9cC Crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16 (see paper)
39% identity, 99% coverage: 1:394/400 of query aligns to 1:387/393 of 4o9cC
8opxC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with trehalose (fragment-b-tre) (see paper)
37% identity, 99% coverage: 3:398/400 of query aligns to 3:396/398 of 8opxC
>WP_079646942.1 NCBI__GCF_900167915.1:WP_079646942.1
MREAVIVSTARTPIGKAFRGAFNDTEAPVLGGHVVREVVARAGIDPAMVEDVIMGCAAQQ
GTQGYNLGRLSAAVAGLPDSVAGMTVDRQCSSGLMAIAIAARQIMFDGMDVAVGAGTESI
SLTQNKHKNAYRARSQAAIAASPHMYMPMIETAEIVADRYGVSRAAQDEYSLSSQQRTAA
AHAAGRFAEEIAPLATDMLVTDKATGETSTRRVTLDRDEGARGDTTLEGLASLKPVFSGG
EVIAEGKHITAGNSSQLSDGAAACLLMEASVAAKLGLTPLGALRGLAVAGCAPEEMGIGP
VFAVPKLLERNGLTVDDIDLWELNEAFACQVLYCRDRLGIPQERLNVDGGAIAMGHPFGM
SGARMTGHALLEGRRRGAKRAVVTMCIGGGMGAAGLFEIY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory