SitesBLAST
Comparing WP_079649071.1 NCBI__GCF_900167915.1:WP_079649071.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
Q96PE7 Methylmalonyl-CoA epimerase, mitochondrial; DL-methylmalonyl-CoA racemase; EC 5.1.99.1 from Homo sapiens (Human) (see paper)
51% identity, 94% coverage: 2:134/141 of query aligns to 44:176/176 of Q96PE7
- H50 (= H8) binding Co(2+)
- R104 (≠ E63) to L: in dbSNP:rs6748672
- H122 (= H81) binding Co(2+)
- E172 (= E130) binding Co(2+)
6qh4C Crystal structure of human methylmalonyl-coa epimerase (mcee) p.Arg143cys variant
52% identity, 91% coverage: 3:131/141 of query aligns to 9:135/138 of 6qh4C
3oa4A Crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125
39% identity, 94% coverage: 2:134/141 of query aligns to 1:132/138 of 3oa4A
6wf6A Streptomyces coelicolor methylmalonyl-coa epimerase (see paper)
38% identity, 94% coverage: 3:135/141 of query aligns to 2:139/141 of 6wf6A
6wfhA Streptomyces coelicolor methylmalonyl-coa epimerase substrate complex (see paper)
38% identity, 94% coverage: 3:135/141 of query aligns to 2:139/139 of 6wfhA
- active site: H7 (= H8), E43 (≠ V45), Q60 (≠ E56), H84 (= H81), E134 (= E130)
- binding cobalt (ii) ion: H7 (= H8), Q60 (≠ E56), H84 (= H81), E134 (= E130)
- binding (3S,5R,9R,19E)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9,19-tetrahydroxy-8,8,20-trimethyl-10,14-dioxo-2,4,6-trioxa-18-thia-11,15-diaza-3,5-diphosphahenicos-19-en-21-oic acid 3,5-dioxide (non-preferred name): H7 (= H8), Q39 (= Q41), Q60 (≠ E56), A70 (≠ P66), K73 (≠ G69), W74 (≠ F70), H83 (= H80), H84 (= H81), L107 (= L104), G114 (= G110), S115 (≠ A111), F122 (= F118), P125 (= P121), K126 (≠ R122), L132 (= L128), E134 (= E130)
6xbqA Streptomyces coelicolor methylmalonyl-coa epimerase in complex with carboxy-carba(dethia)-coa
38% identity, 94% coverage: 2:134/141 of query aligns to 1:138/144 of 6xbqA
- active site: H7 (= H8), E43 (≠ V45), Q60 (≠ E56), H84 (= H81), E134 (= E130)
- binding carboxymethyldethia coenzyme *a: Q39 (= Q41), Q60 (≠ E56), A70 (≠ P66), K73 (≠ G69), W74 (≠ F70), H83 (= H80), H84 (= H81), L107 (= L104), F122 (= F118), P125 (= P121), K126 (≠ R122), L132 (= L128)
- binding cobalt (ii) ion: H7 (= H8), Q60 (≠ E56), H84 (= H81), E134 (= E130)
6wfiA Methylmalonyl-coa epimerase in complex with 2-nitronate-propionyl-coa (see paper)
38% identity, 94% coverage: 2:134/141 of query aligns to 1:138/144 of 6wfiA
- active site: H7 (= H8), E43 (≠ V45), Q60 (≠ E56), H84 (= H81), E134 (= E130)
- binding cobalt (ii) ion: H7 (= H8), Q60 (≠ E56), H84 (= H81), E134 (= E130)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: H7 (= H8), Q39 (= Q41), Q60 (≠ E56), A70 (≠ P66), K73 (≠ G69), W74 (≠ F70), H83 (= H80), H84 (= H81), L107 (= L104), G114 (= G110), S115 (≠ A111), I120 (= I116), F122 (= F118), P125 (= P121), L132 (= L128), E134 (= E130)
6wf7A Methylmalonyl-coa epimerase in complex with methylmalonyl-coa and nh4+ (see paper)
38% identity, 94% coverage: 2:134/141 of query aligns to 1:138/144 of 6wf7A
- active site: H7 (= H8), E43 (≠ V45), Q60 (≠ E56), H84 (= H81), E134 (= E130)
- binding (S)-Methylmalonyl-Coenzyme A: Q39 (= Q41), E43 (≠ V45), Q60 (≠ E56), A70 (≠ P66), W74 (≠ F70), H83 (= H80), H84 (= H81), L107 (= L104), G114 (= G110), S115 (≠ A111), F122 (= F118), P125 (= P121), K126 (≠ R122), L132 (= L128), E134 (= E130)
- binding methylmalonyl-coenzyme a: Q39 (= Q41), Q60 (≠ E56), A70 (≠ P66), W74 (≠ F70), H83 (= H80), H84 (= H81), L107 (= L104), G114 (= G110), S115 (≠ A111), I120 (= I116), F122 (= F118), P125 (= P121), K126 (≠ R122), L132 (= L128), E134 (= E130)
6xbtA Streptomyces coelicolor methylmalonyl-coa epimerase (q60a) in complex with 2-nitronate-propionyl-coa
38% identity, 95% coverage: 2:135/141 of query aligns to 1:139/140 of 6xbtA
- active site: H7 (= H8), E43 (≠ V45), A60 (≠ E56), H84 (= H81), E134 (= E130)
- binding cobalt (ii) ion: H7 (= H8), H84 (= H81), E134 (= E130)
- binding coenzyme a: Q39 (= Q41), A70 (≠ P66), K73 (≠ G69), W74 (≠ F70), K77 (= K73), H83 (= H80), L107 (= L104), F122 (= F118), P125 (= P121), K126 (≠ R122), L132 (= L128)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: H7 (= H8), Q39 (= Q41), A70 (≠ P66), K73 (≠ G69), W74 (≠ F70), H83 (= H80), H84 (= H81), L107 (= L104), G114 (= G110), S115 (≠ A111), P125 (= P121), K126 (≠ R122), L132 (= L128), E134 (= E130)
2qh0A Crystal structure of a glyoxalase from clostridium acetobutylicum
27% identity, 91% coverage: 5:133/141 of query aligns to 3:128/129 of 2qh0A
Query Sequence
>WP_079649071.1 NCBI__GCF_900167915.1:WP_079649071.1
MKLGRLNHVGVATPSIEKSIAFYRDVMGAEVIREPFDLPAQGVKVCFVDTPNSQIELIEP
LGESSPIAGFLAKNPDGGQHHICYEVPDIHAAKAWFEGKGARVLGEPRIGAHGTLIFFVH
PRDMGGVLTEIMETPRPGVSH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory