Comparing WP_081662708.1 NCBI__GCF_000423825.1:WP_081662708.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
54% identity, 98% coverage: 4:839/849 of query aligns to 5:832/841 of 8g3hA
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
36% identity, 97% coverage: 1:820/849 of query aligns to 1:853/1227 of P13009
Sites not aligning to the query:
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
35% identity, 98% coverage: 8:840/849 of query aligns to 26:897/1265 of Q99707
Sites not aligning to the query:
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
32% identity, 71% coverage: 8:611/849 of query aligns to 10:611/611 of 4cczA
5vooA Methionine synthase folate-binding domain with methyltetrahydrofolate from thermus thermophilus hb8 (see paper)
49% identity, 33% coverage: 335:614/849 of query aligns to 1:280/282 of 5vooA
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
33% identity, 67% coverage: 8:573/849 of query aligns to 11:538/560 of 3bofA
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
33% identity, 67% coverage: 8:573/849 of query aligns to 11:538/559 of 1q8jA
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8 (see paper)
67% identity, 25% coverage: 631:839/849 of query aligns to 4:206/507 of 8sseA
Sites not aligning to the query:
3k13C Structure of the pterin-binding domain metr of 5- methyltetrahydrofolate-homocysteine methyltransferase from bacteroides thetaiotaomicron
33% identity, 33% coverage: 339:615/849 of query aligns to 7:287/287 of 3k13C
1bmtA How a protein binds b12: a 3.O angstrom x-ray structure of the b12- binding domains of methionine synthase (see paper)
44% identity, 23% coverage: 629:820/849 of query aligns to 9:203/246 of 1bmtA
Sites not aligning to the query:
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
44% identity, 23% coverage: 629:820/849 of query aligns to 9:203/576 of 3ivaA
Sites not aligning to the query:
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
44% identity, 23% coverage: 629:820/849 of query aligns to 9:203/577 of 3bulA
Sites not aligning to the query:
2yckX Methyltransferase bound with tetrahydrofolate (see paper)
32% identity, 29% coverage: 331:572/849 of query aligns to 6:238/272 of 2yckX
2ycjA Methyltransferase bound with methyltetrahydrofolate (see paper)
32% identity, 29% coverage: 331:572/849 of query aligns to 5:237/271 of 2ycjA
2yciX Methyltransferase native (see paper)
32% identity, 29% coverage: 331:572/849 of query aligns to 5:237/271 of 2yciX
7xcnP Crystal structure of the mttb-mttc complex at 2.7 a resolution (see paper)
32% identity, 20% coverage: 658:827/849 of query aligns to 36:209/215 of 7xcnP
4djfA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate and ti(iii) citrate reductant (see paper)
31% identity, 28% coverage: 336:571/849 of query aligns to 1:227/262 of 4djfA
4djeA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate (see paper)
31% identity, 28% coverage: 336:571/849 of query aligns to 1:227/262 of 4djeA
4djdA Crystal structure of folate-free corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr) (see paper)
31% identity, 28% coverage: 336:571/849 of query aligns to 1:227/262 of 4djdA
2e7fA 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase complexed with methyltetrahydrofolate to 2.2 angsrom resolution (see paper)
31% identity, 28% coverage: 336:571/849 of query aligns to 1:227/262 of 2e7fA
>WP_081662708.1 NCBI__GCF_000423825.1:WP_081662708.1
MSAFMERLRERVLIADGGMGTSLHTFDLDLDKDYWGLENCSEVLVLSRPDVVAAVHKSFF
DAGSDCVETDTFGANKVVLAEFGLSERTFEINEKAAQIARGVADALSTPEWPRFVIGSIG
PGTKLPSLGHTSYDVLEDSYAEQARGLIAGGVDLLLIETAQDILQVKAAVNGCKIARAEA
GMDVPIFAQVTIETTGTMLVGTDIAAAATAIHALGVDGMGMNCATGPAEMSEHVRWLGEN
WPHLISVMPNAGLPMLVEGQTVYPLGPRELADWMLRYVEEDGVNLVGGCCGTTPEHIRAL
REAIGFDRRPRARSPEWVPAVSSLYSQVPLRQENAVLAVGERANANGSKKFRELLAAEDW
DAMVGVARDQVKEGSHVLDVCTAYVGRPEVADMQEVVNRYRGQVTVPLMIDSTEVPVLEA
ALKLLGGKSIINSINFEDGEEKAERVLGFARKYGAAVVALTIDEEGMAKEVEQKLAIAHR
LYDFAVKRYGLPASDLIYDPLTFTICTGVEEDRRHGINTLEAIERIRRELPECQIMLGLS
NISFGLKPAARHVLNSVFLHHAQKRGLTAAIIHVAAIKPLHQIPPEHVEAAEDLIFDRRD
KGFDPLLRFVELFKDVTVASAKKAAPATVEERLTQRIVDGDKQGLEDDLKAALEQYPPLE
IINTFLLDGMKVVGELFGSGQMQLPFVLQSAETMKAAVAFLEPFMEKVEGEEKGILVLAT
VKGDVHDIGKNLVDIILTNNGYKVVNLGIKQPIDSIVQAACDCGAHAIGMSGLLVKSTVI
MKENLEEMRRRGLDIPVLLGGAALTRRFVENDCRAAYGHPERVHYAKDAFEGLKLMEQIM
AWDAARRAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory