Comparing WP_082797879.1 NCBI__GCF_001584165.1:WP_082797879.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
8wm8B Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with nitrate (see paper)
32% identity, 42% coverage: 130:249/288 of query aligns to 107:226/265 of 8wm8B
A0A0H2ZQB9 Ergothioneine transporter EgtUBC from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
33% identity, 50% coverage: 136:279/288 of query aligns to 61:203/506 of A0A0H2ZQB9
Sites not aligning to the query:
B5Z7I3 Ergothioneine transport permease/ergothioneine binding protein EgtU from Helicobacter pylori (strain G27) (see paper)
28% identity, 40% coverage: 106:221/288 of query aligns to 69:184/553 of B5Z7I3
Sites not aligning to the query:
>WP_082797879.1 NCBI__GCF_001584165.1:WP_082797879.1
MSELSVTFAPLELPQDGGEQLSSLQQQRRAVPVRRLSDRSVTLLTVFCLLGLWWLVTASA
LVPPLFLPSPLAVLQKIKSVALDGFVDATLWQHTATSVARVLAALLLAIATAIPIGILIG
LSNRARAVFDPLIEFYRPIPPLAYLPLIVIWFGIGELSKVLLIYLAIFAPLAIATLHGVR
RVDQNRLRAAQTLGASRWQLIRFVILPSAVPDILTGVRIGLGVGWSTLVAAELIAATRGL
GFMIQSAAQFLVTDVVIMGILVIALIASAFEYGLRWLQRKYVPWEGRT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory