Comparing WP_083442179.1 NCBI__GCF_000969705.1:WP_083442179.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
44% identity, 93% coverage: 1:275/295 of query aligns to 12:285/295 of 5ktlA
P9WP25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
46% identity, 92% coverage: 1:270/295 of query aligns to 19:284/300 of P9WP25
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
46% identity, 92% coverage: 1:270/295 of query aligns to 15:280/296 of 1xxxA
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
46% identity, 92% coverage: 1:270/295 of query aligns to 16:281/297 of 5j5dA
Sites not aligning to the query:
5ud6C Crystal structure of dhdps from cyanidioschyzon merolae with lysine bound
42% identity, 95% coverage: 1:279/295 of query aligns to 11:292/299 of 5ud6C
3l21B The crystal structure of a dimeric mutant of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis - dhdps- a204r
46% identity, 92% coverage: 1:270/295 of query aligns to 14:279/295 of 3l21B
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
39% identity, 94% coverage: 1:276/295 of query aligns to 14:287/307 of 4fhaA
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
35% identity, 95% coverage: 1:280/295 of query aligns to 10:290/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
35% identity, 95% coverage: 1:280/295 of query aligns to 9:289/294 of Q9X1K9
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
38% identity, 94% coverage: 1:276/295 of query aligns to 9:285/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
38% identity, 94% coverage: 1:276/295 of query aligns to 9:285/291 of 3u8gA
Sites not aligning to the query:
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
38% identity, 94% coverage: 1:276/295 of query aligns to 9:285/291 of 3tdfA
Sites not aligning to the query:
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
38% identity, 94% coverage: 1:276/295 of query aligns to 9:285/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
38% identity, 94% coverage: 1:276/295 of query aligns to 9:285/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
38% identity, 94% coverage: 1:276/295 of query aligns to 9:285/291 of 3pueB
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
39% identity, 95% coverage: 1:281/295 of query aligns to 9:288/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
39% identity, 95% coverage: 1:281/295 of query aligns to 9:288/292 of P0A6L2
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
39% identity, 95% coverage: 1:281/295 of query aligns to 10:289/293 of 5t25A
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
38% identity, 95% coverage: 1:281/295 of query aligns to 9:288/292 of 3i7sA
Sites not aligning to the query:
4pfmA Shewanella benthica dhdps with lysine and pyruvate
40% identity, 96% coverage: 1:283/295 of query aligns to 10:291/295 of 4pfmA
>WP_083442179.1 NCBI__GCF_000969705.1:WP_083442179.1
MITPFTSDGALDLDGAQTLADHLVSNGTDTVLVHGTTGESPTLLGEEMWELLAAVKDAVG
DRANVMMGSGSNATATAIRSTQRATEMGADSLLVVTPYYNKPDQRGLVRHFRAVAEVTDL
PIVLYDIKPRTATAIEVSTMVDLAEVPNIVGTKDASGEWAKVGDVLVATEGAPGGFGVWS
GADEFNLGSIATGATGVISVAAHLVGRELAEMIDVFATDPLRARQLHLACLPLHRALFAE
PSPAPLKAAMNELGLPAGPVRLPLAEASPEATRTVLDALERVRTTLASTSGAPTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory