Comparing WP_083478354.1 NCBI__GCF_001418105.1:WP_083478354.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P39841 Putative mannose-6-phosphate isomerase YvyI; Phosphohexomutase; Phosphomannose isomerase; PMI; EC 5.3.1.8 from Bacillus subtilis (strain 168)
35% identity, 95% coverage: 4:312/324 of query aligns to 1:305/316 of P39841
1qwrA Crystal structure analysis of the mannose 6-phosphate isomerase from bacillus subtilis
35% identity, 94% coverage: 8:312/324 of query aligns to 4:304/315 of 1qwrA
1zx5A The structure of a putative mannosephosphate isomerase from archaeoglobus fulgidus
24% identity, 96% coverage: 15:324/324 of query aligns to 15:298/300 of 1zx5A
>WP_083478354.1 NCBI__GCF_001418105.1:WP_083478354.1
MSNMLTYPIKFEPILKEKIWGGQKLHTLLKKESALPNIGESWEISDVDHDISIVNNGVLK
GKTLKELLETYKADLIGNKNYQAFGNTFPLLIKFIDAKEDLSIQLHPNDALASKRHNSFG
KTEMWYVLQAEDDARLIVGFNQEMTSEKYVKHLEAKTLPEILNFDKVKEGDSYFVEVGQI
HAIGAGVMLAEIQQTSDVTYRIYDWDRVDSNGNQRELHNDLAIDAINFKSQEDFKVSYSK
AENEANEMVDCPYFTCNYIEITETINKENKVDSFIIYMCVSGEVEIVTAHHTVKIKKGET
VLLPAAIKTYQISSKKGRLLEVYV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory