SitesBLAST

Comparing WP_083492030.1 NCBI__GCF_001431535.1:WP_083492030.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Found 20 (the maximum) hits to proteins with known functional sites

5x40A Structure of a cbio dimer bound with amppcp (see paper)
35% identity, 86% coverage: 12:236/261 of query aligns to 16:230/280 of 5x40A

• binding phosphomethylphosphonic acid adenylate ester: V18 (= V14), A20 (≠ V16), N40 (= N36), G41 (= G37), G43 (= G39), K44 (= K40), S45 (= S41), T46 (= T42), Q88 (≠ G85), H139 (≠ A145), M140 (≠ E146), L141 (= L147), S142 (= S148), G144 (= G150), Q145 (≠ E151), Q166 (≠ E172), H198 (= H204)
• binding magnesium ion: S45 (= S41), Q88 (≠ G85)

Sites not aligning to the query:

• binding phosphomethylphosphonic acid adenylate ester: 14

P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 89% coverage: 15:247/261 of query aligns to 31:248/378 of P69874

• F45 (≠ H29) mutation to L: Lower ATPase activity and transport efficiency.
• C54 (= C38) mutation to T: Loss of ATPase activity and transport.
• L60 (≠ I44) mutation to F: Lower ATPase activity and transport efficiency.
• L76 (vs. gap) mutation to P: Lower ATPase activity and transport efficiency.
• V135 (≠ S134) mutation to M: Loss of ATPase activity and transport.
• D172 (= D171) mutation to N: Loss of ATPase activity and transport.

Sites not aligning to the query:

• 26 C→A: Lower ATPase activity and transport efficiency.
• 27 F→L: Lower ATPase activity and transport efficiency.
• 276 C→A: Lower ATPase activity and transport efficiency.
• 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.

P21439 Phosphatidylcholine translocator ABCB4; ATP-binding cassette sub-family B member 4; Multidrug resistance protein 3; P-glycoprotein 3; EC 7.6.2.1 from Homo sapiens (Human) (see 22 papers)
32% identity, 86% coverage: 11:234/261 of query aligns to 1046:1267/1286 of P21439

• R1046 (= R11) binding
• 1071:1077 (vs. 36:42, 86% identical) binding
• K1075 (= K40) mutation to M: Inhibits efflux activity for PC and cholesterol, but does not alter glycosylation and surface expression in the presence of taurocholate.
• L1082 (≠ I47) to Q: in a heterozygous patient with amoxicillin/clavulanic acid-induced cholestasis; dbSNP:rs1214110864
• Q1124 (≠ G85) binding
• E1125 (≠ D86) to K: in PFIC3; alters efflux activity for PC
• P1168 (≠ S120) to S: in GBD1; reduced phosphatidylcholine transporter activity; does not alter plasma membrane location; dbSNP:rs121918442
• S1183 (= S148) to L: in GBD1; severely reduced phosphatidylcholine transporter activity; does not alter plasma membrane location
• GGQ 1184:1186 (≠ AGE 149:151) binding
• G1185 (= G150) to S: in GBD1; loss of phosphatidylcholine transporter activity; does not alter plasma membrane location

Sites not aligning to the query:

• 34 modified: Phosphothreonine; T → M: in GBD1; reduces efflux activity for PC in a phosphorylation-dependent manner; dbSNP:rs142794414; T→D: Does not inhibit efflux activity for PC.
• 44 T→A: Reduces efflux activity for PC. Does not alter apical membrane location.
• 47 R → G: in GBD1; partly retained intracellularly; reduces efflux activity for PC in a phosphorylation-dependent manner; R → Q: found in patients with cholangitis; uncertain significance; dbSNP:rs372685632
• 49 S→A: Reduces efflux activity for PC. Does not alter apical membrane location.
• 68 G → R: in PFIC3; retained in the reticulum endoplasmic; greatly reduced expression; dbSNP:rs1343667900
• 73 L → V: in PFIC3 and GBD1; dbSNP:rs8187788
• 87 natural variant: D -> E
• 95 P → S: in dbSNP:rs377268767
• 175 T → A: found in patients with gallbladder and cholestasis; uncertain significance; dbSNP:rs58238559
• 201 T → M: in PFIC3; greatly reduced expression; alters efflux activity for PC; dbSNP:rs753318087
• 238 L → V: in dbSNP:rs45596335
• 263 I → V: in dbSNP:rs45547936
• 286 A → V: in PFIC3 and GBD1; does not alter plasma membrane location; inhibits efflux activity for PC; dbSNP:rs765478923
• 320 S → F: in ICP3, GBD1 and PFIC3; uncertain significance; does not alter plasma membrane location; does not inhibit efflux activity for PC; dbSNP:rs72552778
• 367 I → V: in dbSNP:rs1168923653
• 403 Y → H: in PFIC3; does not alter cytoplasmic and cell membrane location; inhibits efflux activity for PC and cholesterol; dbSNP:rs121918443
• 406 binding ; R → Q: found in patients with cholangitis; uncertain significance; dbSNP:rs763807769
• 432:437 binding
• 435 K→M: Inhibits efflux activity for PC and cholesterol, but does not alter glycosylation and surface expression in the presence of taurocholate.
• 450 E → G: in dbSNP:rs1189003716
• 459 D → H: in PFIC3; retained in the reticulum endoplasmic; greatly reduced expression
• 477 binding
• 479 P → L: in PFIC3; greatly reduced expression; alters efflux activity for PC; dbSNP:rs748657435
• 481 L → R: in PFIC3; does not alter cytoplasmic and cell membrane location; inhibits efflux activity for PC and cholesterol
• 511 A → T: in PFIC3 and GBD1; dbSNP:rs1257887155
• 528 E → D: in GBD1; uncertain significance; moderate decrease of phosphatidylcholine transporter activity; does not alter plasma membrane location; dbSNP:rs8187797
• 535 G → D: in PFIC3; reduced phosphatidylcholine transporter activity; does not alter plasma membrane location
• 536 binding ; G → R: in GBD1; loss of phosphatidylcholine transporter activity; does not alter plasma membrane location
• 541 I → F: in PFIC3 and GBD1; dbSNP:rs66904256
• 546 A → D: in ICP3; disruption of protein trafficking with subsequent lack of functional protein at the cell surface; dbSNP:rs121918441
• 558 E→Q: Loss of floppase activity. Strongly reduce the ATPase activity.
• 589 H → T: in GBD1; requires 2 nucleotide substitutions
• 590 R → Q: found in patients with gallbladder and cholestasis; uncertain significance; dbSNP:rs45575636
• 651 T → N: in dbSNP:rs45476795
• 652 R → G: in dbSNP:rs2230028
• 726 P → L: in GBD1; loss of phosphatidylcholine transporter activity; does not alter plasma membrane location; dbSNP:rs141677867
• 742 natural variant: G -> S
• 764 I → L: in a heterozygous patient with risperidone-induced cholestasis
• 775 T → M: found in patients with cholangitis; uncertain significance; dbSNP:rs148052192
• 788 R → Q: in GBD1; benign; dbSNP:rs8187801
• 934 A → T: found in patients with gallbladder and cholestasis; uncertain significance; dbSNP:rs61730509
• 953 A→D: Accumulates predominantly in intracellular compartments with only a small fraction at the plasma membrane and inhibits partially the efflux activity for PC.
• 964 V → T: found in patients with cholangitis; uncertain significance; requires 2 nucleotide substitutions
• 978 S → P: in PFIC3; alters efflux activity for PC; dbSNP:rs1051861187
• 985 V→M: Significantly reduces phosphatidylcholine floppase activity; when associated with Q-989 and V-990.
• 989 H→Q: Significantly reduces phosphatidylcholine floppase activity; when associated with M-985 and V-990.
• 990 A→V: Significantly reduces phosphatidylcholine floppase activity; when associated with M-985 and Q-989.

7niwA Nanodisc reconstituted human abcb4 in complex with 4b1-fab (posaconazole-bound, inward-open conformation) (see paper)
30% identity, 82% coverage: 11:224/261 of query aligns to 935:1139/1140 of 7niwA

Sites not aligning to the query:

• binding cholesterol: 70, 152, 160, 266, 641, 645, 648, 839
• binding 1,2-dilinoleoyl-sn-glycero-3-phosphocholine: 173, 183, 250, 254, 257, 261, 286, 294, 298, 617, 882
• binding posaconazole: 250, 291, 294, 658, 661, 726, 841, 871, 874, 878, 882

6s7pA Nucleotide bound abcb4 (see paper)
30% identity, 82% coverage: 11:224/261 of query aligns to 923:1127/1128 of 6s7pA

• binding adenosine-5'-triphosphate: R923 (= R11), S948 (≠ N36), G949 (= G37), G951 (= G39), K952 (= K40), S953 (= S41), T954 (= T42), Q994 (≠ G85), F1033 (≠ A115), S1053 (= S148), G1054 (≠ A149), Q1056 (≠ E151)
• binding magnesium ion: S953 (= S41), Q994 (≠ G85)

Sites not aligning to the query:

• binding adenosine-5'-triphosphate: 342, 344, 345, 371, 373, 374, 375, 416, 471, 473, 475, 476, 920, 922
• binding cholesterol: 25, 32, 35, 65, 824, 834, 834, 838

Q00748 Multidrug resistance protein homolog 65; P-glycoprotein 65; EC 7.6.2.2 from Drosophila melanogaster (Fruit fly) (see paper)
30% identity, 86% coverage: 11:234/261 of query aligns to 417:629/1302 of Q00748

Sites not aligning to the query:

• 103 modified: carbohydrate, N-linked (GlcNAc...) asparagine

6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
29% identity, 84% coverage: 17:236/261 of query aligns to 20:229/229 of 6z67B

• binding phosphoaminophosphonic acid-adenylate ester: S39 (≠ N36), G40 (= G37), G42 (= G39), K43 (= K40), S44 (= S41), T45 (= T42)

Sites not aligning to the query:

• binding phosphoaminophosphonic acid-adenylate ester: 13, 16, 19

6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
29% identity, 84% coverage: 17:236/261 of query aligns to 20:229/230 of 6z4wA

• binding adenosine-5'-diphosphate: G40 (= G37), G42 (= G39), K43 (= K40), S44 (= S41), T45 (= T42)

Sites not aligning to the query:

• binding adenosine-5'-diphosphate: 13, 17, 19

A0A0H2ZM82 Cell division ATP-binding protein FtsE from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
29% identity, 84% coverage: 17:236/261 of query aligns to 20:229/230 of A0A0H2ZM82

• K43 (= K40) mutation to A: Growth cessation and formation of spherical cells with aberrant division planes.
• D164 (= D171) mutation to A: Growth cessation and formation of spherical cells with aberrant division planes.
• E165 (= E172) mutation to A: Growth cessation and formation of spherical cells with aberrant division planes.

4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 87% coverage: 12:237/261 of query aligns to 12:227/240 of 4ymuJ

• binding adenosine-5'-triphosphate: V16 (= V16), S36 (≠ N36), G37 (= G37), S38 (≠ C38), G39 (= G39), K40 (= K40), S41 (= S41), T42 (= T42), E162 (= E172), H194 (= H204)
• binding magnesium ion: S41 (= S41), E162 (= E172)

Sites not aligning to the query:

• binding adenosine-5'-triphosphate: 11

7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
33% identity, 87% coverage: 2:229/261 of query aligns to 4:223/262 of 7chaI

• binding phosphoaminophosphonic acid-adenylate ester: R13 (= R11), S38 (≠ N36), G39 (= G37), C40 (= C38), G41 (= G39), K42 (= K40), T43 (≠ S41), T44 (= T42)

P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
27% identity, 91% coverage: 16:252/261 of query aligns to 26:254/265 of P07821

• K50 (= K40) mutation to Q: Lack of activity.
• D172 (= D171) mutation to E: Lack of activity.
• E173 (= E172) mutation to A: Lack of activity.

4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 86% coverage: 12:235/261 of query aligns to 13:225/241 of 4u00A

• binding adenosine-5'-diphosphate: V17 (= V16), S37 (≠ N36), G38 (= G37), S39 (≠ C38), G40 (= G39), K41 (= K40), S42 (= S41), T43 (= T42)

Sites not aligning to the query:

• binding adenosine-5'-diphosphate: 12

4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
30% identity, 85% coverage: 12:233/261 of query aligns to 15:223/285 of 4yerA

• binding adenosine-5'-diphosphate: F17 (≠ V14), N39 (= N36), G40 (= G37), G42 (= G39), K43 (= K40), T44 (≠ S41), T45 (= T42), T135 (≠ E146), F136 (≠ L147), S137 (= S148)

Sites not aligning to the query:

• binding adenosine-5'-diphosphate: 14

2pmkA Crystal structures of an isolated abc-atpase in complex with tnp-adp (see paper)
29% identity, 85% coverage: 16:236/261 of query aligns to 20:229/243 of 2pmkA

• binding spiro(2,4,6-trinitrobenzene[1,2a]-2o',3o'-methylene-adenine-triphosphate: G41 (= G37), S42 (≠ C38), G43 (= G39), K44 (= K40), S45 (= S41), T46 (= T42), K49 (= K45)
• binding adenosine-5'-diphosphate: I20 (≠ V16), S40 (≠ N36), G41 (= G37), S42 (≠ C38), G43 (= G39), K44 (= K40), S45 (= S41), T46 (= T42)

Sites not aligning to the query:

• binding spiro(2,4,6-trinitrobenzene[1,2a]-2o',3o'-methylene-adenine-triphosphate: 13
• binding adenosine-5'-diphosphate: 13

2ff7A The abc-atpase of the abc-transporter hlyb in the adp bound state (see paper)
29% identity, 85% coverage: 16:236/261 of query aligns to 20:229/243 of 2ff7A

• binding adenosine-5'-diphosphate: I20 (≠ V16), G41 (= G37), S42 (≠ C38), G43 (= G39), K44 (= K40), S45 (= S41), T46 (= T42)

Sites not aligning to the query:

• binding adenosine-5'-diphosphate: 13

O70127 Bile salt export pump; ATP-binding cassette sub-family B member 11; Sister of P-glycoprotein; EC 7.6.2.- from Rattus norvegicus (Rat) (see 3 papers)
29% identity, 86% coverage: 11:234/261 of query aligns to 1090:1304/1321 of O70127

Sites not aligning to the query:

• 109 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Impairs N-glycosylation; when associated with Q-116; Q-122 and Q-125. Significantly decreases taurocholate; when associated with Q-116; Q-122 and Q-125. Significantly decreases protein expression; when associated with Q-116; Q-122 and Q-125. Affects protein localization at the apical membrane; when associated with Q-116; Q-122 and Q-125. Does not affect protein localization at the apical membrane.
• 116 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Impairs N-glycosylation; when associated with Q-109; Q-122 and Q-125. Significantly decreases taurocholate; when associated with Q-109; Q-122 and Q-125. Significantly decreases protein expression; when associated with Q-109; Q-122 and Q-125. Affects protein localization at the apical membrane; when associated with Q-109; Q-122 and Q-125. Does not affect protein localization at the apical membrane; when associated with Q-109; Q-122 and Q-125.
• 122 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Impairs N-glycosylation; when associated with Q-109; Q-116 and Q-125. Significantly decreases taurocholate; when associated with Q-109; Q-116 and Q-125. Significantly decreases protein expression; when associated with Q-109; Q-116 and Q-125. Affects protein localization at the apical membrane; when associated with Q-109; Q-116 and Q-125.
• 125 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Impairs N-glycosylation; when associated with Q-109; Q-116 and Q-122. Significantly decreases taurocholate; when associated with Q-109; Q-116 and Q-122. Significantly decreases protein expression; when associated with Q-109; Q-116 and Q-122. Affects protein localization at the apical membrane;when associated with Q-109; Q-116 and Q-122.
• 651:674 Interaction with HAX1
• 1311 Y→A: Deacreases ABCB11 internalization.

3b5jA Crystal structures of the s504a mutant of an isolated abc-atpase in complex with tnp-adp (see paper)
29% identity, 85% coverage: 16:236/261 of query aligns to 20:229/243 of 3b5jA

• binding 2',3'-O-[(1R,6R)-2,4,6-trinitrocyclohexa-2,4-diene-1,1-diyl]adenosine 5'-(trihydrogen diphosphate): I20 (≠ V16), G41 (= G37), S42 (≠ C38), G43 (= G39), K44 (= K40), S45 (= S41), T46 (= T42)

Sites not aligning to the query:

• binding 2',3'-O-[(1R,6R)-2,4,6-trinitrocyclohexa-2,4-diene-1,1-diyl]adenosine 5'-(trihydrogen diphosphate): 13

7sgrE Structure of hemolysin a secretion system hlyb/d complex (see paper)
29% identity, 85% coverage: 16:236/261 of query aligns to 478:687/700 of 7sgrE

Sites not aligning to the query:

• binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: 142, 145, 148, 210, 301, 377, 385, 388

8wm7D Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
29% identity, 87% coverage: 11:238/261 of query aligns to 18:230/257 of 8wm7D

• binding adenosine-5'-diphosphate: Y21 (≠ V14), V23 (= V16), S43 (≠ N36), G44 (= G37), C45 (= C38), G46 (= G39), K47 (= K40), S48 (= S41), T49 (= T42)

Sites not aligning to the query:

• binding adenosine-5'-diphosphate: 14

Query Sequence

>WP_083492030.1 NCBI__GCF_001431535.1:WP_083492030.1
MIELDRASVMRGQVKVLHGLSLRIAQGQHTALLGPNGCGKSTFIKLITRELYPLAHADGH
VPVKVLGQNRWQVDRLRSQLGIVTGDLSNNLADMPGLTVEQAVLTGFFASYVLPAFREIS
QDMRDRARATLAMSGALALHGRTYAELSAGETRRVLIARALVNRPHALLLDEPSTGLDLV
ARQQLVDTMQSLARQGITLVLVTHHVEEIIPEIERVVLLRDGRVLADGTRAELLCDAPLS
ALFGGPITVREHEGRLSAHAR