SitesBLAST
Comparing WP_083536532.1 NCBI__GCF_001579945.1:WP_083536532.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
36% identity, 70% coverage: 17:308/419 of query aligns to 31:317/533 of O43175
- T78 (≠ A61) binding
- R135 (≠ K129) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ AI 149:150) binding
- D175 (= D169) binding
- T207 (≠ V204) binding
- CAR 234:236 (≠ FSR 231:233) binding
- D260 (≠ R252) binding
- V261 (≠ A253) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (= HLGA 274:277) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
36% identity, 68% coverage: 17:299/419 of query aligns to 26:303/303 of 6plgA
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
36% identity, 68% coverage: 17:299/419 of query aligns to 27:304/305 of 6plfA
7dkmA Phgdh covalently linked to oridonin (see paper)
36% identity, 68% coverage: 17:299/419 of query aligns to 27:304/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ A61), A102 (≠ V89), G148 (= G146), R151 (≠ A149), I152 (= I150), Y170 (≠ F168), D171 (= D169), P172 (= P170), I173 (≠ Q171), H202 (= H203), T203 (≠ V204), P204 (= P205), T209 (= T210), C230 (≠ F231), A231 (≠ S232), R232 (= R233), H279 (= H274), G281 (= G276)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (≠ I288)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
36% identity, 67% coverage: 17:298/419 of query aligns to 26:302/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V145), G147 (= G146), L148 (= L147), G149 (= G148), R150 (≠ A149), I151 (= I150), G152 (= G151), D170 (= D169), H201 (= H203), T202 (≠ V204), P203 (= P205)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
36% identity, 67% coverage: 17:298/419 of query aligns to 26:302/302 of 6rihA
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
36% identity, 67% coverage: 17:298/419 of query aligns to 23:299/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G148), I148 (= I150), Y166 (≠ F168), D167 (= D169), P168 (= P170), I169 (≠ Q171), I170 (= I172), H198 (= H203), T199 (≠ V204), L208 (= L213), R228 (= R233)
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
37% identity, 64% coverage: 17:286/419 of query aligns to 25:289/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N85), A100 (≠ V89), R149 (≠ A149), I150 (= I150), Y168 (≠ F168), D169 (= D169), P170 (= P170), I171 (≠ Q171), H200 (= H203), T201 (≠ V204), P202 (= P205), T207 (= T210), C228 (≠ F231), A229 (≠ S232), R230 (= R233), H277 (= H274), G279 (= G276)
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
36% identity, 67% coverage: 17:297/419 of query aligns to 26:301/301 of 6rj5A
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
37% identity, 64% coverage: 17:286/419 of query aligns to 25:289/297 of 6rj3A
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
37% identity, 67% coverage: 16:297/419 of query aligns to 21:292/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ A149), Y160 (≠ F168), D161 (= D169), P162 (= P170), I164 (= I172), L179 (= L190), T193 (≠ V204), P194 (= P205), S198 (≠ D209), L202 (= L213)
1psdA The allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase (see paper)
32% identity, 81% coverage: 53:390/419 of query aligns to 70:403/404 of 1psdA
- active site: N102 (= N85), R234 (= R233), D258 (= D257), E263 (≠ A261), H286 (= H274)
- binding nicotinamide-adenine-dinucleotide: N102 (= N85), H155 (≠ A149), I156 (= I150), D175 (= D169), I176 (≠ V174), K179 (≠ A177), H204 (= H203), V205 (= V204), P206 (= P205), A232 (≠ F231), S233 (= S232), R234 (= R233), H286 (= H274)
- binding serine: H338 (≠ N327), N340 (= N329), R341 (≠ V330), V344 (≠ M333)
P0A9T0 D-3-phosphoglycerate dehydrogenase; PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 81% coverage: 53:390/419 of query aligns to 76:409/410 of P0A9T0
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ybaA The active form of phosphoglycerate dehydrogenase (see paper)
32% identity, 81% coverage: 53:390/419 of query aligns to 72:405/406 of 1ybaA
- active site: N104 (= N85), R236 (= R233), D260 (= D257), E265 (≠ A261), H288 (= H274)
- binding 2-oxoglutaric acid: C79 (≠ G60), I80 (≠ A61)
- binding nicotinamide-adenine-dinucleotide: I80 (≠ A61), F102 (≠ G83), V108 (= V89), G154 (= G146), G156 (= G148), H157 (≠ A149), I158 (= I150), Y176 (≠ F168), D177 (= D169), I178 (≠ V174), K181 (≠ A177), H206 (= H203), V207 (= V204), P208 (= P205), A234 (≠ F231), S235 (= S232), R236 (= R233), H288 (= H274), G290 (= G276)
- binding phosphate ion: G81 (= G62), N83 (= N64)
Sites not aligning to the query:
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 91% coverage: 4:384/419 of query aligns to 56:456/466 of P87228
- S87 (≠ N33) modified: Phosphoserine
- S258 (≠ L207) modified: Phosphoserine
2p9eA Crystal structure of g336v mutant of e.Coli phosphoglycerate dehydrogenase (see paper)
32% identity, 81% coverage: 53:390/419 of query aligns to 72:405/406 of 2p9eA
- active site: N104 (= N85), R236 (= R233), D260 (= D257), E265 (≠ A261), H288 (= H274)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G156 (= G148), H157 (≠ A149), I158 (= I150), Y176 (≠ F168), D177 (= D169), I178 (≠ V174), H206 (= H203), V207 (= V204), P208 (= P205), S212 (≠ D209), A234 (≠ F231), S235 (= S232), R236 (= R233), H288 (= H274), G290 (= G276)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
39% identity, 63% coverage: 35:299/419 of query aligns to 43:303/304 of 1wwkA
- active site: S96 (≠ N85), R230 (= R233), D254 (= D257), E259 (≠ R262), H278 (= H274)
- binding nicotinamide-adenine-dinucleotide: V100 (= V89), G146 (= G146), F147 (≠ L147), G148 (= G148), R149 (≠ A149), I150 (= I150), Y168 (≠ F168), D169 (= D169), P170 (= P170), V201 (= V204), P202 (= P205), T207 (= T210), T228 (≠ F231), S229 (= S232), D254 (= D257), H278 (= H274), G280 (= G276)
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
38% identity, 71% coverage: 10:308/419 of query aligns to 21:312/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
37% identity, 71% coverage: 10:308/419 of query aligns to 20:311/526 of 3dc2A
Sites not aligning to the query:
1sc6D Crystal structure of w139g d-3-phosphoglycerate dehydrogenase complexed with NAD+ (see paper)
32% identity, 81% coverage: 53:390/419 of query aligns to 70:383/384 of 1sc6D
- active site: N102 (= N85), R228 (= R233), D252 (= D257)
- binding nicotinamide-adenine-dinucleotide: P99 (= P82), F100 (≠ G83), N102 (= N85), T103 (≠ A86), G146 (= G146), G148 (= G148), H149 (≠ A149), I150 (= I150), Y168 (≠ F168), D169 (= D169), I170 (≠ V174), H198 (= H203), V199 (= V204), P200 (= P205), S204 (≠ D209), T205 (= T210), S227 (= S232)
Query Sequence
>WP_083536532.1 NCBI__GCF_001579945.1:WP_083536532.1
MNTFRVLTLNNISVRGLERLPRERYEVASEFTNPDAIIVRSADMHRMELPGSLKAVGRAG
AGTNNIPVGALSKRGIPVFNAPGANANAVKELVIAGLFLAARNICQAWEYVRGLSLSDKQ
LDEAVEAGKKKFVGYELPGRTLGVVGLGAIGVEVANAAHALGMRVLGFDPQITVQRAWQL
SSGVEQALSLDDLFSRADMVTVHVPLLEDTRNLINAARLRLFKKDGVILNFSRSGIVDEA
AVLDALNAGALRAYICDFPSARSKDHPKVVALPHLGASTGEAEENCAIIVADTLRDFLEN
GNVRHSVNFPEAVMPRASGGSRLAIANENVPNMVGQISTALATANLNIADLLNKFRGELA
YTLIDVDGGIPDSVIGALQGIEGVLTIRTLQGTTAGRIRGPDTGRVRTMTRDMMMRNSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory