Comparing WP_083763388.1 NCBI__GCF_000009985.1:WP_083763388.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P71063 UDP-N-acetylbacillosamine N-acetyltransferase; EC 2.3.1.203 from Bacillus subtilis (strain 168) (see paper)
37% identity, 87% coverage: 22:232/243 of query aligns to 1:207/216 of P71063
4m99A Acetyltransferase domain of pglb from neisseria gonorrhoeae fa1090 in complex with acetyl coenzyme a (see paper)
38% identity, 86% coverage: 23:230/243 of query aligns to 3:204/206 of 4m99A
4ea9A X-ray structure of gdp-perosamine n-acetyltransferase in complex with transition state analog at 0.9 angstrom resolution (see paper)
41% identity, 77% coverage: 45:231/243 of query aligns to 28:205/207 of 4ea9A
Sites not aligning to the query:
4ea8A X-ray crystal structure of perb from caulobacter crescentus in complex with coenzyme a and gdp-n-acetylperosamine at 1 angstrom resolution (see paper)
41% identity, 77% coverage: 45:231/243 of query aligns to 28:205/207 of 4ea8A
Sites not aligning to the query:
4eaaA X-ray crystal structure of the h141n mutant of perosamine n- acetyltransferase from caulobacter crescentus in complex with coa and gdp-perosamine (see paper)
41% identity, 77% coverage: 45:231/243 of query aligns to 28:207/210 of 4eaaA
Sites not aligning to the query:
7txsA X-ray structure of the viob n-aetyltransferase from acinetobacter baumannii in the presence of a reaction intermediate (see paper)
33% identity, 87% coverage: 22:233/243 of query aligns to 1:206/209 of 7txsA
7txqA X-ray structure of the viob n-acetyltransferase from acinetobacter baumannii in the present of tdp and acetyl-coenzymea (see paper)
33% identity, 87% coverage: 22:233/243 of query aligns to 1:206/209 of 7txqA
7txpA X-ray structure of the viob n-acetyltransferase from acinetobacter baumannii in complex with tdp-4-amino-4,6-dideoxy-d-glucose (see paper)
33% identity, 87% coverage: 22:233/243 of query aligns to 1:206/209 of 7txpA
5t2yA Crystal structure of c. Jejuni pgld in complex with 5-methyl-4- (methylamino)-2-phenethylthieno[2,3-d]pyrimidine-6-carboxylic acid (see paper)
27% identity, 86% coverage: 23:230/243 of query aligns to 4:190/192 of 5t2yA
Q0P9D1 UDP-N-acetylbacillosamine N-acetyltransferase; Protein glycosylation D; UDP-4-amino-4,6-dideoxy-N-acetyl-alpha-D-glucosamine N-acetyltransferase; EC 2.3.1.203 from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) (see 2 papers)
27% identity, 86% coverage: 23:230/243 of query aligns to 5:193/195 of Q0P9D1
3bssA Pgld from campylobacter jejuni, nctc 11168, with native substrate (see paper)
27% identity, 86% coverage: 23:230/243 of query aligns to 4:192/194 of 3bssA
2vheA Pgld-coa complex: an acetyl transferase from campylobacter jejuni (see paper)
27% identity, 86% coverage: 23:230/243 of query aligns to 4:192/194 of 2vheA
Sites not aligning to the query:
3bsyA Pgld from campylobacter jejuni, nctc 11168, in complex with acetyl coenzyme a (see paper)
27% identity, 86% coverage: 23:230/243 of query aligns to 3:191/193 of 3bsyA
5tyhA Pgld from campylobacter jejuni nctc 11168 in complex with 5-(2- furanyl)-1h-pyrazole-3-carboxylic acid (see paper)
31% identity, 65% coverage: 74:230/243 of query aligns to 29:183/185 of 5tyhA
7l7yAAA Putative acetyl transferase protein (see paper)
32% identity, 68% coverage: 68:233/243 of query aligns to 48:217/217 of 7l7yAAA
Sites not aligning to the query:
7l82AAA Putative acetyl transferase protein (see paper)
32% identity, 68% coverage: 68:232/243 of query aligns to 48:216/216 of 7l82AAA
Sites not aligning to the query:
7l81AAA Putative acetyl transferase protein (see paper)
32% identity, 68% coverage: 68:232/243 of query aligns to 48:216/216 of 7l81AAA
Sites not aligning to the query:
7l7zAAA Putative acetyl transferase protein (see paper)
32% identity, 68% coverage: 68:232/243 of query aligns to 48:216/216 of 7l7zAAA
Sites not aligning to the query:
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
33% identity, 45% coverage: 122:231/243 of query aligns to 23:139/290 of 4mzuB
Sites not aligning to the query:
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
33% identity, 45% coverage: 122:231/243 of query aligns to 23:140/294 of 4mzuF
Sites not aligning to the query:
>WP_083763388.1 NCBI__GCF_000009985.1:WP_083763388.1
MPNCPTKRLEPSFPPSARNWPVHRIVIWGAGDQGRVDKPIVDRLGLGLAAMVDDTPGLAP
PFPGVPLLQGFDAFLAWLATQQAHDLSFVIAIGNPYGHVRRHLAQKLAALGLSPFSLIDP
TAMVSAGVVLGTGLQMMPFALVHVDAVVGDQCIVNTRATVEHDCVLADGVEIGPGATLCG
RVHVGRDTWIGAGATVLPRLAIGANSIVGAGAVVTRDIPDNVVVAGNPAKVLRPNLVRAS
KHV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory