Comparing WP_083763391.1 NCBI__GCF_000009985.1:WP_083763391.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P16387 Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial; Pyruvate dehydrogenase complex component E1 alpha; PDHE1-A; EC 1.2.4.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
30% identity, 45% coverage: 6:302/654 of query aligns to 70:378/420 of P16387
Sites not aligning to the query:
P11177 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; PDHE1-B; EC 1.2.4.1 from Homo sapiens (Human) (see 6 papers)
29% identity, 49% coverage: 333:654/654 of query aligns to 39:358/359 of P11177
Sites not aligning to the query:
1qs0B Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) (see paper)
29% identity, 47% coverage: 329:633/654 of query aligns to 7:318/338 of 1qs0B
6cfoB Human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate (see paper)
29% identity, 49% coverage: 333:654/654 of query aligns to 10:329/330 of 6cfoB
6cerD Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
29% identity, 49% coverage: 333:654/654 of query aligns to 11:330/331 of 6cerD
P26284 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial; PDHE1-A type I; EC 1.2.4.1 from Rattus norvegicus (Rat) (see paper)
30% identity, 39% coverage: 16:268/654 of query aligns to 61:317/390 of P26284
P35486 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial; PDHE1-A type I; EC 1.2.4.1 from Mus musculus (Mouse) (see 2 papers)
30% identity, 39% coverage: 16:268/654 of query aligns to 61:317/390 of P35486
Sites not aligning to the query:
Q5SLR3 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
34% identity, 43% coverage: 329:612/654 of query aligns to 6:281/324 of Q5SLR3
P29803 Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial; PDHE1-A type II; EC 1.2.4.1 from Homo sapiens (Human) (see 4 papers)
29% identity, 39% coverage: 15:268/654 of query aligns to 58:315/388 of P29803
1umdD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
34% identity, 43% coverage: 329:612/654 of query aligns to 5:280/323 of 1umdD
1umcD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
34% identity, 43% coverage: 329:612/654 of query aligns to 5:280/323 of 1umcD
1umbD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
34% identity, 43% coverage: 329:612/654 of query aligns to 5:280/323 of 1umbD
P26267 Pyruvate dehydrogenase E1 component subunit alpha type I, mitochondrial; PDHA1; PDHE1-A; EC 1.2.4.1 from Ascaris suum (Pig roundworm) (Ascaris lumbricoides) (see paper)
30% identity, 40% coverage: 6:269/654 of query aligns to 46:314/396 of P26267
P21953 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDE1B; BCKDH E1-beta; EC 1.2.4.4 from Homo sapiens (Human) (see 2 papers)
28% identity, 42% coverage: 328:603/654 of query aligns to 72:340/392 of P21953
1dtwB Human branched-chain alpha-keto acid dehydrogenase (see paper)
28% identity, 42% coverage: 328:603/654 of query aligns to 6:274/326 of 1dtwB
2j9fD Human branched-chain alpha-ketoacid dehydrogenase-decarboxylase e1b (see paper)
28% identity, 42% coverage: 328:603/654 of query aligns to 9:277/329 of 2j9fD
3dv0D Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
28% identity, 50% coverage: 329:654/654 of query aligns to 5:323/324 of 3dv0D
3dv0B Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
28% identity, 50% coverage: 329:654/654 of query aligns to 5:323/324 of 3dv0B
3dufD Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
28% identity, 50% coverage: 329:654/654 of query aligns to 5:323/324 of 3dufD
1w85B The crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 (see paper)
28% identity, 50% coverage: 329:654/654 of query aligns to 5:323/324 of 1w85B
>WP_083763391.1 NCBI__GCF_000009985.1:WP_083763391.1
MQSALPDMAQAEAKKGQDHFATATLIRVVEERLLSLYGEGRLHGTVHTCIGQEWTGVSVA
SALRSGDYILSNHRGHGHYLAWTDDVEGLIAEVMGRESGVCRGRGGSQHLRGQGFFSNGI
IGGMAPVAAGLAMAHRLAGDGGVAVLFIGDGGLGQGALFEALNLAASFSLPLVVLVEANG
IAQSTPVDTVQAGSAVGRARAFGIEARESDTWNPEDLLRAVSATVDTARREGRPLLHLVR
TFRLMPHSKGDDTRAPDLIEEYRLKDPVTQWLAEGGPDAARVRAAAVERVEAAVAKAAAA
PPGLVPSTSPPCYAKPVNLVPVRACEGRLVEHIRAGLDAAMAADDRLLLLGEDICSPYGG
AFKVTSGLSDSYPGRVFNTPISEAGLVGVGAGLALAGRRVVAEIMFGDFLTLVADQLINH
AAKFTQMYGEDVEVPLLVRTPMGGRRGYGPTHSQSLETHFFGVPGLTVLAIHHRMDAAAF
YARLIATAKTPHLIIENKVAYGVDCARDRLQGFSYVETDDDLPTLVVRPCVQAQVTILGY
GGMLLEMEKAMDRLFEDADIVTEAICPVALYPSNMQALLDSVSLTRRLVVVEEGQGYAGY
GAEAVAFLHQHLPGGFSLRRLSALPTAIPCSREGEAACLVSAKDIVEAVQEILS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory