Comparing WP_083763404.1 AMB_RS01605 aspartate aminotransferase family protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
43% identity, 99% coverage: 1:381/384 of query aligns to 12:391/393 of 2ordA
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
43% identity, 99% coverage: 1:381/384 of query aligns to 4:383/385 of Q9X2A5
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
42% identity, 100% coverage: 1:383/384 of query aligns to 13:398/402 of 4jevB
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
42% identity, 100% coverage: 1:383/384 of query aligns to 18:403/405 of P40732
4adbB Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
45% identity, 96% coverage: 1:369/384 of query aligns to 13:384/401 of 4adbB
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
45% identity, 96% coverage: 1:369/384 of query aligns to 13:384/400 of 4addA
4jewA N-acetylornithine aminotransferase from s. Typhimurium complexed with l-canaline
41% identity, 100% coverage: 1:383/384 of query aligns to 13:393/397 of 4jewA
2pb0A Structure of biosynthetic n-acetylornithine aminotransferase from salmonella typhimurium: studies on substrate specificity and inhibitor binding (see paper)
41% identity, 100% coverage: 1:383/384 of query aligns to 7:387/389 of 2pb0A
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
41% identity, 98% coverage: 1:376/384 of query aligns to 5:372/376 of O66442
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
41% identity, 98% coverage: 1:376/384 of query aligns to 4:371/375 of 2eh6A
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 98% coverage: 3:378/384 of query aligns to 72:451/457 of Q9M8M7
Sites not aligning to the query:
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
42% identity, 98% coverage: 3:380/384 of query aligns to 13:389/390 of 8ht4B
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
41% identity, 99% coverage: 1:381/384 of query aligns to 12:384/390 of A0QYS9
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
38% identity, 99% coverage: 1:380/384 of query aligns to 5:385/388 of 3nx3A
P9WPZ7 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
43% identity, 99% coverage: 1:382/384 of query aligns to 20:395/400 of P9WPZ7
Sites not aligning to the query:
7nncC Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal-5'-phosphate and 6-methoxyquinoline-3-carboxylic acid
43% identity, 99% coverage: 1:382/384 of query aligns to 14:389/391 of 7nncC
7nn4A Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid.
43% identity, 99% coverage: 1:382/384 of query aligns to 14:389/391 of 7nn4A
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
37% identity, 96% coverage: 4:373/384 of query aligns to 24:387/395 of Q5SHH5
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
37% identity, 97% coverage: 3:373/384 of query aligns to 15:379/387 of 1wkhA
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
37% identity, 97% coverage: 3:373/384 of query aligns to 15:379/387 of 1wkgA
Sites not aligning to the query:
>WP_083763404.1 AMB_RS01605 aspartate aminotransferase family protein
MPTYARADLAFERGEGAYLFTADGRRYLDFAAGVAVNALGHCHPRLVKALTAQAAKVWHT
SNLYRVAGQESVAAKLVERSFADTVFFCNSGAEALECSIKMARRHHFAAGNPQRYRIICA
EGAFHGRTLATVAAGGQKKHLEGFAPAVDGFDHVPYGNLNALRASITEETAAILVEPVQG
EGGIVPGDPDYLRRLRATADEFGLLLIFDEVQTGMGRTGTLFAHEQAGIAPDIMGVAKGL
GGGFPVGACLATTKAASGMVPGTHGSTFGGNPLAMAVAGEVLDIMAEPGFLEHVQAMAAL
LRSKVEDTAARFPGVVEEVRGLGLMLGIKPRMPNTEMVARLAEGGLLTVGAGDNIVRLLP
PLIINDAQVDEAVGILARAFDEVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory