SitesBLAST
Comparing WP_083763485.1 NCBI__GCF_000009985.1:WP_083763485.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6hulB Sulfolobus solfataricus tryptophan synthase ab complex (see paper)
50% identity, 87% coverage: 34:446/475 of query aligns to 1:410/416 of 6hulB
- binding pyridoxal-5'-phosphate: H103 (= H135), K104 (= K136), Q131 (= Q163), S220 (= S253), G255 (= G288), G256 (= G289), G257 (= G290), S258 (= S291), N259 (= N292), E371 (= E407), S400 (= S436), G401 (= G437)
- binding serine: K104 (= K136), T127 (= T159), G128 (= G160), A129 (= A161), G130 (= G162), W132 (= W164)
4qysB Trpb2 enzymes (see paper)
44% identity, 87% coverage: 32:446/475 of query aligns to 6:412/418 of 4qysB
- active site: K101 (= K136), E123 (= E158), S402 (= S436)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: H100 (= H135), K101 (= K136), G252 (= G288), G253 (= G289), G254 (= G290), S255 (= S291), N256 (= N292), E373 (= E407), S402 (= S436)
4qysA Trpb2 enzymes (see paper)
43% identity, 87% coverage: 32:446/475 of query aligns to 6:402/408 of 4qysA
- active site: K108 (= K136), E130 (= E158), S392 (= S436)
- binding pyridoxal-5'-phosphate: H107 (= H135), K108 (= K136), G242 (= G288), G243 (= G289), G244 (= G290), S245 (= S291), N246 (= N292), E363 (= E407), S392 (= S436)
- binding phosphoserine: K108 (= K136), G132 (= G160), A133 (= A161), Q135 (= Q163), W136 (= W164), G316 (= G360), R318 (= R362), E363 (= E407)
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
33% identity, 73% coverage: 99:443/475 of query aligns to 44:376/383 of 5vm5D
- active site: K82 (= K136), E104 (= E158), S369 (= S436)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H135), K82 (= K136), T105 (= T159), G106 (= G160), A107 (= A161), Q109 (= Q163), H110 (≠ W164), S185 (= S253), G227 (= G288), G229 (= G290), S230 (= S291), N231 (= N292), G296 (= G360), E343 (= E407), S369 (= S436)
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
33% identity, 73% coverage: 99:443/475 of query aligns to 44:376/383 of 5t6mA
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
33% identity, 73% coverage: 99:443/475 of query aligns to 44:376/394 of 5ixjD
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
33% identity, 73% coverage: 99:443/475 of query aligns to 44:378/384 of 7rnpA
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
32% identity, 73% coverage: 99:443/475 of query aligns to 44:377/383 of 5dw3A
- active site: K82 (= K136), E104 (= E158), S370 (= S436)
- binding tryptophan: K82 (= K136), E104 (= E158), T105 (= T159), G106 (= G160), A107 (= A161), Q109 (= Q163), H110 (≠ W164), S185 (= S253), G228 (= G289), Y300 (= Y363)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
33% identity, 73% coverage: 99:443/475 of query aligns to 44:378/385 of 6am8B
- active site: K82 (= K136), E104 (= E158), S371 (= S436)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H135), K82 (= K136), E104 (= E158), T105 (= T159), G106 (= G160), A107 (= A161), Q109 (= Q163), H110 (≠ W164), L161 (= L230), S185 (= S253), V187 (≠ L255), G227 (= G288), G228 (= G289), G229 (= G290), S230 (= S291), N231 (= N292), G298 (= G360), Y301 (= Y363), E345 (= E407), S371 (= S436), G372 (= G437)
- binding tryptophan: L169 (≠ V238), S274 (≠ L338), H275 (≠ T339)
Sites not aligning to the query:
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
33% identity, 73% coverage: 99:443/475 of query aligns to 44:378/388 of 5dw0A
- active site: K82 (= K136), E104 (= E158), S371 (= S436)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H135), K82 (= K136), T105 (= T159), G106 (= G160), A107 (= A161), Q109 (= Q163), H110 (≠ W164), S185 (= S253), G227 (= G288), G229 (= G290), S230 (= S291), N231 (= N292), G298 (= G360), D300 (≠ R362), E345 (= E407), S371 (= S436)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
33% identity, 73% coverage: 99:443/475 of query aligns to 44:378/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
33% identity, 73% coverage: 99:443/475 of query aligns to 44:378/386 of 1v8zA
- active site: K82 (= K136), E104 (= E158), S371 (= S436)
- binding pyridoxal-5'-phosphate: H81 (= H135), K82 (= K136), Q109 (= Q163), S185 (= S253), G227 (= G288), G228 (= G289), G229 (= G290), S230 (= S291), N231 (= N292), E345 (= E407), S371 (= S436), G372 (= G437)
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
33% identity, 73% coverage: 99:443/475 of query aligns to 44:378/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H135), K82 (= K136), T105 (= T159), G106 (= G160), A107 (= A161), Q109 (= Q163), H110 (≠ W164), S185 (= S253), G227 (= G288), G229 (= G290), S230 (= S291), N231 (= N292), G298 (= G360), E345 (= E407), S371 (= S436)
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
33% identity, 73% coverage: 99:443/475 of query aligns to 44:378/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H135), K82 (= K136), T105 (= T159), G106 (= G160), A107 (= A161), Q109 (= Q163), H110 (≠ W164), S185 (= S253), G227 (= G288), G229 (= G290), S230 (= S291), N231 (= N292), G298 (= G360), E345 (= E407), S371 (= S436)
5ey5B Lbcats
34% identity, 72% coverage: 102:444/475 of query aligns to 49:379/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H135), K82 (= K136), Q109 (= Q163), S185 (= S253), G227 (= G288), G229 (= G290), S230 (= S291), N231 (= N292), E345 (= E407), S371 (= S436), G372 (= G437)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
32% identity, 79% coverage: 75:450/475 of query aligns to 32:401/406 of 5tciH
Sites not aligning to the query:
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
32% identity, 79% coverage: 75:450/475 of query aligns to 31:400/405 of 6uapB
- active site: K97 (= K136), E119 (= E158), S386 (= S436)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (= I234), N181 (≠ S235), F184 (≠ V238), Y196 (= Y249), F198 (≠ L251), P204 (vs. gap), F207 (vs. gap), H290 (≠ K325)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
32% identity, 73% coverage: 102:450/475 of query aligns to 65:401/405 of 6u6cB
- active site: K98 (= K136), E120 (= E158), S387 (= S436)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H135), K98 (= K136), T121 (= T159), G122 (= G160), A123 (= A161), Q125 (= Q163), H126 (≠ W164), T201 (≠ S253), G243 (= G288), G245 (= G290), S246 (= S291), N247 (= N292), G314 (= G360), E361 (= E407), S387 (= S436)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: F185 (≠ V238), W188 (≠ I240), Y197 (= Y249), F199 (≠ L251), G204 (vs. gap), P205 (vs. gap), H291 (≠ K325), G292 (= G326)
Sites not aligning to the query:
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
32% identity, 73% coverage: 102:450/475 of query aligns to 64:400/404 of 6usaB
- active site: K97 (= K136), E119 (= E158), S386 (= S436)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H135), K97 (= K136), T120 (= T159), G121 (= G160), A122 (= A161), G123 (= G162), Q124 (= Q163), H125 (≠ W164), T200 (≠ S253), G242 (= G288), G244 (= G290), S245 (= S291), N246 (= N292), G313 (= G360), E360 (= E407), S386 (= S436)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ V238), W187 (≠ I240), Y196 (= Y249), F198 (≠ L251), G203 (vs. gap), P204 (vs. gap), F207 (vs. gap), H290 (≠ K325), G291 (= G326)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
32% identity, 73% coverage: 102:450/475 of query aligns to 64:400/404 of 6dweB
- active site: K97 (= K136), E119 (= E158), S386 (= S436)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ V238), Y196 (= Y249), F198 (≠ L251), P204 (vs. gap), F207 (vs. gap), H290 (≠ K325)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H135), K97 (= K136), T120 (= T159), G121 (= G160), A122 (= A161), G123 (= G162), Q124 (= Q163), H125 (≠ W164), T200 (≠ S253), G242 (= G288), G244 (= G290), S245 (= S291), N246 (= N292), G313 (= G360), E360 (= E407), S386 (= S436)
Query Sequence
>WP_083763485.1 NCBI__GCF_000009985.1:WP_083763485.1
MTPSERKTIPAISHPARGRGNAAMTESTKYLLSEDRLPKAWYNLNADLPVPAPPPLHPGT
GQPIGPDDLAPIFPMAVIAQEVTAERWVEIPEPVREVYRLWRPAPLIRARRLEKALGTPA
RIYFKYEGVSPAGSHKPNTSVPQAFYNQQEGVKRLATETGAGQWGSSLAFAGSLFGLEVE
VFMVKVSYEQKPYRRALMETYGAKCIASPSNLTHAGRSILEKDPHSNGSLGIAISEAVEI
AASRDDTKYALGSVLNHVCLHQTIIGEEAMMQMEMADDHPDVVIACTGGGSNFAGLAFPY
IRENLKGGKTRVIGVEPASCPTLTKGLYAYDFGDTGKLTPLVKMHTLGATFMPPGSHAGG
LRYHGMAPMVSHVKELGLMEARAYHQTECFAAAVQFARAEGIVPAPESSHAVKGAIDEAL
RCKAEGKAETILFNLSGHGHFDMQAYTDFFAGKLKDNTYAEADLQAALAELPNVG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory