SitesBLAST
Comparing WP_083763535.1 NCBI__GCF_000009985.1:WP_083763535.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8U1K9 NAD(P)H:rubredoxin oxidoreductase; NROR; Rubredoxin--NAD(P)(+) reductase; EC 1.18.1.4 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
30% identity, 56% coverage: 43:423/676 of query aligns to 2:356/359 of Q8U1K9
6rvhA Nadh-dependent coenzyme a disulfide reductase soaked with menadione (see paper)
36% identity, 37% coverage: 80:331/676 of query aligns to 40:295/443 of 6rvhA
- active site: C44 (≠ I84), E53 (≠ D93), E58 (≠ G97), Y159 (≠ V193), E163 (= E197)
- binding coenzyme a: S40 (≠ N80), Y41 (= Y81), C44 (≠ I84), R63 (≠ H102)
- binding flavin-adenine dinucleotide: A43 (≠ R83), C44 (≠ I84), V81 (= V120), T113 (= T147), G114 (= G148), R134 (= R168), Y159 (≠ V193), G280 (= G314), D281 (≠ E315)
Sites not aligning to the query:
- active site: 39, 425, 430
- binding coenzyme a: 20, 23, 303, 307, 359, 431, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 34, 35, 297, 298, 299, 424, 425
- binding menadione: 364, 365, 430, 431
6rvbA Nadh-dependent coenzyme a disulfide reductase soaked with nadh (see paper)
36% identity, 37% coverage: 80:331/676 of query aligns to 40:295/443 of 6rvbA
- active site: C44 (≠ I84), E53 (≠ D93), E58 (≠ G97), Y159 (≠ V193), E163 (= E197)
- binding coenzyme a: S40 (≠ N80), Y41 (= Y81), C44 (≠ I84), R63 (≠ H102)
- binding flavin-adenine dinucleotide: A43 (≠ R83), C44 (≠ I84), E80 (≠ P119), V81 (= V120), T113 (= T147), G114 (= G148), L133 (≠ F167), R134 (= R168), I160 (≠ L194), G280 (= G314), D281 (≠ E315)
- binding nicotinamide-adenine-dinucleotide: G156 (= G190), G158 (= G192), Y159 (≠ V193), I160 (≠ L194), E179 (≠ H213), A180 (≠ L214), A240 (= A276), T241 (≠ V277), G242 (= G278)
Sites not aligning to the query:
- active site: 39, 425, 430
- binding coenzyme a: 15, 20, 23, 303, 307, 359, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 36, 298, 299, 424, 425
- binding nicotinamide-adenine-dinucleotide: 297, 328, 329
6ruzA Nadh-dependent coenzyme a disulfide reductase (see paper)
36% identity, 37% coverage: 80:331/676 of query aligns to 40:295/443 of 6ruzA
- active site: C44 (≠ I84), E53 (≠ D93), E58 (≠ G97), Y159 (≠ V193), E163 (= E197)
- binding coenzyme a: S40 (≠ N80), Y41 (= Y81), C44 (≠ I84), R63 (≠ H102)
- binding flavin-adenine dinucleotide: A43 (≠ R83), C44 (≠ I84), E80 (≠ P119), V81 (= V120), T113 (= T147), G114 (= G148), A115 (= A149), L133 (≠ F167), R134 (= R168), Y159 (≠ V193), G280 (= G314), D281 (≠ E315)
Sites not aligning to the query:
- active site: 39, 425, 430
- binding coenzyme a: 15, 19, 20, 23, 303, 307, 359, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 297, 298, 299, 424, 425
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
36% identity, 40% coverage: 44:316/676 of query aligns to 4:275/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (= G50), V11 (≠ M51), G12 (≠ A52), D34 (≠ A75), E35 (= E76), R42 (= R83), P43 (≠ I84), K47 (vs. gap), E78 (≠ P119), V79 (= V120), T106 (= T147), G107 (= G148), G273 (= G314), D274 (≠ E315)
- binding nicotinamide-adenine-dinucleotide: R111 (≠ L152), G149 (= G190), L152 (≠ V193), I153 (≠ L194), E156 (= E197), E172 (≠ H213), A173 (≠ L214), R180 (= R221), V236 (= V277), G237 (= G278), A238 (≠ I279)
Sites not aligning to the query:
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
36% identity, 40% coverage: 44:316/676 of query aligns to 5:276/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (= G50), V12 (≠ M51), G13 (≠ A52), D35 (≠ A75), E36 (= E76), R43 (= R83), P44 (≠ I84), S47 (= S87), K48 (vs. gap), V80 (= V120), T107 (= T147), G108 (= G148), R128 (= R168), G274 (= G314), D275 (≠ E315)
Sites not aligning to the query:
8c0zE Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
32% identity, 45% coverage: 45:345/676 of query aligns to 4:312/424 of 8c0zE
1xhcA Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779- 001
33% identity, 45% coverage: 43:343/676 of query aligns to 2:288/346 of 1xhcA
- active site: P10 (≠ M51), K38 (≠ R83), P39 (≠ I84), F145 (≠ V193), E149 (= E197), M276 (≠ W331)
- binding flavin-adenine dinucleotide: V6 (= V47), G7 (= G48), G9 (= G50), P10 (≠ M51), G11 (≠ A52), D29 (≠ G74), K30 (≠ A75), K38 (≠ R83), P39 (≠ I84), E74 (≠ P119), A75 (≠ V120), A100 (= A146), T101 (= T147), G102 (= G148), L119 (≠ F167), R120 (= R168), F145 (≠ V193), I146 (≠ L194), E149 (= E197), G259 (= G314), D260 (≠ E315), G270 (= G325), T271 (≠ L326), A272 (≠ V327)
3lxdA Crystal structure of ferredoxin reductase arr from novosphingobium aromaticivorans (see paper)
31% identity, 49% coverage: 70:403/676 of query aligns to 31:368/409 of 3lxdA
- active site: R44 (= R83), P45 (≠ I84), N302 (≠ W331)
- binding flavin-adenine dinucleotide: R36 (≠ A75), E37 (= E76), R44 (= R83), P45 (≠ I84), S48 (= S87), K49 (≠ S88), E81 (≠ P119), V82 (= V120), T109 (= T147), I157 (≠ L194), G278 (= G314), D279 (≠ E315), S297 (vs. gap), V298 (= V327), F325 (≠ S354), W326 (≠ L355)
Sites not aligning to the query:
2v3aA Crystal structure of rubredoxin reductase from pseudomonas aeruginosa. (see paper)
32% identity, 55% coverage: 41:409/676 of query aligns to 1:363/381 of 2v3aA
- active site: L11 (≠ M51), K42 (≠ R83), P43 (≠ I84), M290 (≠ W331)
- binding flavin-adenine dinucleotide: I7 (≠ V47), G8 (= G48), T9 (≠ N49), G10 (= G50), A12 (= A52), T33 (≠ G74), A34 (= A75), D35 (≠ E76), K42 (≠ R83), P43 (≠ I84), R79 (≠ P119), V80 (= V120), A105 (= A146), W106 (≠ T147), G107 (= G148), I153 (≠ L194), F157 (≠ A198), D274 (≠ E315), L284 (≠ G325), Y285 (≠ L326), V286 (= V327), K317 (= K360)
Q9HTK9 Rubredoxin-NAD(+) reductase; RdxR; EC 1.18.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
32% identity, 55% coverage: 40:409/676 of query aligns to 3:366/384 of Q9HTK9
8a56B Coenzyme a-persulfide reductase (coapr) from enterococcus faecalis (see paper)
33% identity, 32% coverage: 99:317/676 of query aligns to 59:281/539 of 8a56B
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 6, 7, 9, 11, 32, 33, 42, 295, 296, 297, 422, 423
- binding 3'-phosphate-adenosine-5'-diphosphate: 17, 18, 21, 305, 356, 430, 435, 438, 505, 506, 509
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
34% identity, 41% coverage: 70:343/676 of query aligns to 29:309/404 of 3fg2P
- binding flavin-adenine dinucleotide: D34 (≠ A75), E35 (= E76), R42 (= R83), P43 (≠ I84), S46 (= S87), K47 (vs. gap), R78 (≠ P119), M79 (≠ V120), T106 (= T147), R127 (= R168), I153 (≠ L194), D275 (≠ E315), S292 (vs. gap), V293 (vs. gap)
Sites not aligning to the query:
Q9AL95 NADH-rubredoxin oxidoreductase; NROR; NADH:rubredoxin oxidoreductase; EC 1.18.1.1 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
24% identity, 55% coverage: 39:411/676 of query aligns to 1:350/379 of Q9AL95
- C26 (≠ A64) modified: Disulfide link with 286
- NSE 33:35 (≠ GAE 74:76) binding
- R42 (= R83) binding
- A79 (≠ V120) binding
- Y125 (≠ R168) binding
- C137 (≠ A180) modified: Disulfide link with 216
- C216 (≠ L272) modified: Disulfide link with 137
- D259 (≠ E315) binding
- C286 (≠ T342) modified: Disulfide link with 26
3kljA Crystal structure of nadh:rubredoxin oxidoreductase from clostridium acetobutylicum (see paper)
25% identity, 55% coverage: 43:411/676 of query aligns to 4:349/378 of 3kljA
- active site: P12 (≠ M51), R41 (= R83), P42 (≠ I84), N274 (≠ W331)
- binding flavin-adenine dinucleotide: L8 (≠ V47), G9 (= G48), G11 (= G50), P12 (≠ M51), A13 (= A52), N32 (≠ G74), S33 (≠ A75), E34 (= E76), R41 (= R83), P42 (≠ I84), F77 (≠ P119), A78 (≠ V120), S105 (≠ T147), G106 (= G148), L123 (≠ F167), Y124 (≠ R168), L150 (= L194), G257 (= G314), D258 (≠ E315), G268 (= G325), L269 (= L326), I270 (≠ V327), A273 (≠ L330), K301 (= K360)
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
33% identity, 32% coverage: 130:344/676 of query aligns to 99:322/541 of 6pfzA
Sites not aligning to the query:
- active site: 37, 42, 455, 456
- binding calcium ion: 332, 427, 428
- binding coenzyme a: 14, 18, 21, 38, 40, 42, 76, 430, 447, 512, 513, 516
- binding flavin-adenine dinucleotide: 7, 11, 32, 33, 41, 42, 86
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
33% identity, 36% coverage: 85:324/676 of query aligns to 47:292/422 of 1q1wA
Sites not aligning to the query:
- active site: 13, 44, 45, 305
- binding flavin-adenine dinucleotide: 10, 12, 13, 14, 35, 36, 44, 45, 300, 301, 329
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
33% identity, 36% coverage: 85:324/676 of query aligns to 48:293/422 of P16640
- K50 (≠ S87) binding
- V83 (= V120) binding
- R134 (= R168) binding
- D284 (≠ E315) binding
Sites not aligning to the query:
- 15 binding
- 37 binding
- 302 binding
3cgeA Pyridine nucleotide complexes with bacillus anthracis coenzyme a- disulfide reductase: a structural analysis of dual NAD(p)h specificity (see paper)
31% identity, 33% coverage: 111:332/676 of query aligns to 71:295/444 of 3cgeA
- binding flavin-adenine dinucleotide: V80 (= V120), T112 (= T147), G113 (= G148), G281 (= G314), D282 (≠ E315)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I156 (≠ V189), G157 (= G190), A160 (≠ V193), I161 (≠ L194), E164 (= E197), E180 (≠ H213), R181 (≠ L214), N182 (≠ T215), T187 (≠ R221), V242 (= V277), G243 (= G278)
Sites not aligning to the query:
- active site: 10, 37, 41, 42, 304
- binding coenzyme a: 17, 21, 38, 42, 61, 304, 308, 441, 442
- binding flavin-adenine dinucleotide: 6, 9, 10, 11, 31, 32, 33, 41, 42, 299, 300, 303, 425, 426
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 298, 299
3cgdA Pyridine nucleotide complexes with bacillus anthracis coenzyme a- disulfide reductase: a structural analysis of dual NAD(p)h specificity (see paper)
31% identity, 33% coverage: 111:332/676 of query aligns to 71:295/444 of 3cgdA
- binding flavin-adenine dinucleotide: V80 (= V120), A111 (= A146), T112 (= T147), G281 (= G314), D282 (≠ E315)
- binding nicotinamide-adenine-dinucleotide: I156 (≠ V189), G157 (= G190), G159 (= G192), A160 (≠ V193), I161 (≠ L194), E164 (= E197), E180 (≠ H213), R181 (≠ L214), V242 (= V277), G243 (= G278)
Sites not aligning to the query:
- active site: 10, 37, 41, 42, 304
- binding coenzyme a: 17, 18, 21, 38, 39, 42, 61, 304, 308, 441, 442
- binding flavin-adenine dinucleotide: 6, 7, 9, 10, 11, 31, 32, 33, 41, 42, 299, 300, 303, 425, 426
- binding nicotinamide-adenine-dinucleotide: 298, 299
Query Sequence
>WP_083763535.1 NCBI__GCF_000009985.1:WP_083763535.1
MDRLGRLGSVVADRPGGAGPLCAPEEDMTATPAQVSPPLHRQRLVVVGNGMAALRTVEEI
LALAPDRFHITVLGAEPHGNYNRILLSSVLAGDKQVGDIVTHPPGWYAERGIALRTGDPV
VSIDPEHRRVSTASGHVVAWDRLLLATGARPLMPALPGAGLEGVYGFRTIGDVQAMLASA
GRHRRAVVVGGGVLGLEAAWGLRRQGMAVTVIHLTPWLMERQLDEVAAAMLRHDLERHGI
ACLTSAQAARLEGRERVEAVTLSDGRTIAADLVVMAVGIRPNTDLARQAGLEVGRGITVD
ARMRSSAPDIFAVGECVEHDGQCYGLVMPLWDMARVCAHHLTGGEGERLFTPPSLSTRLK
IPGIALFSAGEPAAANDDDRELIHHDPGQSIYKKLVLRRGRLVGAVLYGDVEDSARVWQW
LCDGDDVGHLCAGNLCLGRISGQCAAADPLENLPDDAVVCHCNGVTKGAIVAAIAEHGLT
SLEQVTARTRACSGCGQCAALTARILARTLGEDGAEALAAETRRSEIRAGAFRLWHRANA
VLMSVLAVTGLFLHFAGTPAALLRLEWAFGLHKWSGLTLVAAYGAFLGLTALFRRRWRAN
AEGMVMFVLMPALVVTGLAFLWPVLLPQEPQKVNGIAWVAVVHTVLAIALLMYLIHHLGT
APVQWWRKRKARAFGG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory