Comparing WP_083763540.1 NCBI__GCF_000009985.1:WP_083763540.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8cqxA Ribokinase from t.Sp mutant a92g
34% identity, 86% coverage: 26:292/311 of query aligns to 2:284/300 of 8cqxA
Sites not aligning to the query:
6znxC Ribokinase from thermus species
34% identity, 86% coverage: 26:292/311 of query aligns to 2:249/265 of 6znxC
6a8cA Ribokinase from leishmania donovani with adp (see paper)
27% identity, 87% coverage: 26:295/311 of query aligns to 16:315/327 of 6a8cA
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
27% identity, 87% coverage: 26:295/311 of query aligns to 16:315/327 of 6a8bA
6a8aA Ribokinase from leishmania donovani with atp (see paper)
27% identity, 87% coverage: 26:295/311 of query aligns to 16:315/327 of 6a8aA
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 77% coverage: 26:266/311 of query aligns to 7:265/309 of P0A9J6
Sites not aligning to the query:
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
29% identity, 77% coverage: 26:266/311 of query aligns to 4:262/305 of 1rk2A
Sites not aligning to the query:
1gqtB Activation of ribokinase by monovalent cations (see paper)
29% identity, 77% coverage: 26:266/311 of query aligns to 6:264/307 of 1gqtB
Sites not aligning to the query:
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
26% identity, 90% coverage: 26:304/311 of query aligns to 5:310/313 of 6ilsB
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 90% coverage: 26:304/311 of query aligns to 71:376/379 of A1A6H3
Sites not aligning to the query:
3ikhA Crystal structure of ribokinase in complex with atp and glycerol in the active site from klebsiella pneumoniae
26% identity, 79% coverage: 25:270/311 of query aligns to 3:248/286 of 3ikhA
Sites not aligning to the query:
3i3yD Crystal structure of ribokinase in complex with d-ribose from klebsiella pneumoniae
26% identity, 79% coverage: 25:270/311 of query aligns to 2:247/285 of 3i3yD
7aghA Crystal structure of sf kinase yihv from e. Coli in complex with amppnp-mg (see paper)
27% identity, 70% coverage: 74:291/311 of query aligns to 52:277/295 of 7aghA
8ug3A Crystal structure of khk-c and compound 23 (see paper)
27% identity, 81% coverage: 24:276/311 of query aligns to 4:278/298 of 8ug3A
Sites not aligning to the query:
8omkA Hkhk-c in complex with adp & fructose 1-phosphate
27% identity, 81% coverage: 24:276/311 of query aligns to 4:278/298 of 8omkA
Sites not aligning to the query:
8ug1B Crystal structure of khk-c and compound 13 (see paper)
27% identity, 81% coverage: 24:276/311 of query aligns to 11:285/305 of 8ug1B
Sites not aligning to the query:
3qa2A X-ray structure of ketohexokinase in complex with a pyrimidopyrimidine analog 2 (see paper)
27% identity, 81% coverage: 24:276/311 of query aligns to 3:277/297 of 3qa2A
8omfA Crystal structure of hkhk-c in complex with compound-4 (see paper)
27% identity, 81% coverage: 24:276/311 of query aligns to 2:276/296 of 8omfA
Sites not aligning to the query:
6w0zA Structure of khk in complex with compound 8 (2-[(1~{s},5~{r})-3-[2- [(2~{s})-2-methylazetidin-1-yl]-6-(trifluoromethyl)pyrimidin-4-yl]-3- azabicyclo[3.1.0]hexan-6-yl]ethanoic acid) (see paper)
27% identity, 81% coverage: 24:276/311 of query aligns to 2:276/296 of 6w0zA
Sites not aligning to the query:
6w0yA Structure of khk in complex with compound 6 (2-[(1~{r},5~{s})-3-[5- cyano-6-[(2~{s},3~{r})-2-methyl-3-oxidanyl-azetidin-1-yl]-4- (trifluoromethyl)pyridin-2-yl]-3-azabicyclo[3.1.0]hexan-6-yl]ethanoic acid) (see paper)
27% identity, 81% coverage: 24:276/311 of query aligns to 2:276/296 of 6w0yA
Sites not aligning to the query:
>WP_083763540.1 NCBI__GCF_000009985.1:WP_083763540.1
MTVIMASPGVWSYPEGRSREAVVARIVVLGSVARDEVIRLDHRLREGAHLQGAPPLARLG
GGGANTAIALTHAGHEVSLVAAVGTDPLADELLAELARHGVDIGPVTRISGPSTHSLVLL
DPEGERTIVNLTRARESRPPRRLLDLAADCVYVRSNGQVLEDLLREKAALCPIIAQIRPL
EDGLLPAQVLVGSHGDLDADLLSNPLEAGRQLAGDILRWVVITHGEEGAEAFGVDGRRLR
ATAPDVEVVDTTGAGDAFAAGLAHALALGLDMERALPLAVGWGAAKVTRPGSFLDRETVR
EILKSAPGPRL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory