Comparing WP_083763585.1 NCBI__GCF_000009985.1:WP_083763585.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
1ox4B Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
34% identity, 97% coverage: 4:212/216 of query aligns to 6:212/538 of 1ox4B
Sites not aligning to the query:
1ox5A Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
34% identity, 97% coverage: 4:212/216 of query aligns to 6:212/532 of 1ox5A
Sites not aligning to the query:
P33734 Imidazole glycerol phosphate synthase hisHF; IGP synthase; IGPS; ImGP synthase; EC 4.3.2.10; EC 3.5.1.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
34% identity, 97% coverage: 4:212/216 of query aligns to 3:209/552 of P33734
Sites not aligning to the query:
7ac8B Molecular basis for the unique allosteric activation mechanism of the heterodimeric imidazole glycerol phosphate synthase complex. (see paper)
27% identity, 98% coverage: 5:215/216 of query aligns to 5:199/202 of 7ac8B
2ywcA Crystal structure of gmp synthetase from thermus thermophilus in complex with xmp
28% identity, 64% coverage: 78:216/216 of query aligns to 66:192/475 of 2ywcA
Sites not aligning to the query:
>WP_083763585.1 NCBI__GCF_000009985.1:WP_083763585.1
MTGIVAIIDYGSGNLRSAAKAFERVVAEASLNLSVAVTNDPKVVDRADRVVLPGVGAFAD
CRAGLLALPGMAETLTERVLARGVPFFGICVGMQLMASIGREHGLHAGLGWVAGEVVPLG
VEDQGLKVPHMGWNQLVPDGLSHPLLAGLDSEAHAYFVHSYKFEPANPAHRLAHVEYGGQ
VTAVVGRDNMVGTQFHPEKSQITGLKVISNFLTWTP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory