SitesBLAST
Comparing WP_083772354.1 NCBI__GCF_000025725.1:WP_083772354.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1zxyA Anthranilate phosphoribosyltransferase from sulfolobus solfataricus in complex with prpp and magnesium (see paper)
36% identity, 92% coverage: 9:313/332 of query aligns to 5:309/344 of 1zxyA
- binding magnesium ion: D223 (= D230), E224 (= E231)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: A78 (≠ C84), G79 (= G85), D83 (≠ S89), T87 (= T93), N89 (= N95), S91 (= S97), T92 (≠ S98), K106 (= K113), S118 (= S125), D223 (= D230), E224 (= E231)
2gvqD Anthranilate phosphoribosyl-transferase (trpd) from s. Solfataricus in complex with anthranilate (see paper)
36% identity, 92% coverage: 9:313/332 of query aligns to 5:309/345 of 2gvqD
P50384 Anthranilate phosphoribosyltransferase; EC 2.4.2.18 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 2 papers)
36% identity, 92% coverage: 9:313/332 of query aligns to 5:309/345 of P50384
- T87 (= T93) binding
- K106 (= K113) mutation to Q: Affinity for phosphoribosylpyrophosphate is similar to that of the wild-type enzyme and catalytic efficiency dedreases only 10-fold.
- H107 (= H114) mutation to A: Limited effect on either affinity for anthranilate and catalytic efficiency. 300-fold decrease of the affinity for anthranilate, whereas catalytic efficiency remains nearly unchanged; when associated with A-178.
- S118 (= S125) binding
- H154 (= H161) mutation to A: Limited effect on either affinity for anthranilate and catalytic efficiency.
- R164 (= R171) mutation to A: Strong decrease of the affinity for anthranilate, although only a moderate 7-fold decrease in catalytic efficiency.
- D223 (= D230) mutation to N: Affinity for phosphoribosylpyrophosphate is similar to that of the wild-type enzyme and catalytic efficiency is unchanged.
- E224 (= E231) mutation to Q: Affinity for phosphoribosylpyrophosphate is similar to that of the wild-type enzyme and catalytic efficiency is unchanged.
1kgzB Crystal structure analysis of the anthranilate phosphoribosyltransferase from erwinia carotovora (current name, pectobacterium carotovorum) (see paper)
34% identity, 98% coverage: 7:332/332 of query aligns to 2:327/330 of 1kgzB
- binding manganese (ii) ion: S92 (= S97), D222 (= D230), E223 (= E231), E223 (= E231)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V79 (≠ C84), G82 (= G87), G83 (= G88), N90 (= N95), I91 (≠ V96), S92 (= S97), T93 (≠ S98), K108 (= K113), S118 (= S125)
1gxbA Anthranilate phosphoribosyltransferase in complex with pyrophosphate and magnesium (see paper)
35% identity, 92% coverage: 9:313/332 of query aligns to 5:305/339 of 1gxbA
5nofA Anthranilate phosphoribosyltransferase from thermococcus kodakaraensis (see paper)
35% identity, 95% coverage: 10:323/332 of query aligns to 3:311/325 of 5nofA
4yi7A Anthranilate bound at active site of anthranilate phosphoribosyl transferase from acinetobacter (anprt; trpd)
34% identity, 93% coverage: 19:328/332 of query aligns to 16:318/331 of 4yi7A
3gbrA Anthranilate phosphoribosyl-transferase (trpd) double mutant d83g f149s from s. Solfataricus (see paper)
36% identity, 92% coverage: 9:313/332 of query aligns to 5:306/341 of 3gbrA
- binding manganese (ii) ion: S91 (= S97), D220 (= D230), E221 (= E231), E221 (= E231)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: A78 (≠ C84), G79 (= G85), T80 (= T86), G81 (= G87), N89 (= N95), V90 (= V96), S91 (= S97), T92 (≠ S98), K106 (= K113), G114 (= G121)
4owmA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 3-fluoroanthranilate, prpp and magnesium (see paper)
35% identity, 72% coverage: 20:258/332 of query aligns to 16:255/346 of 4owmA
- active site: V82 (≠ C84)
- binding 2-azanyl-3-fluoranyl-benzoic acid: P156 (= P158), H159 (= H161), Y162 (≠ M164), R163 (≠ K165), A166 (≠ G168), R170 (= R172)
- binding magnesium ion: S95 (= S97), D227 (= D230), E228 (= E231), E228 (= E231)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G85), G86 (= G88), N93 (= N95), S95 (= S97), T96 (≠ S98), K111 (= K113), A117 (≠ M119), S118 (= S120), S119 (≠ G121), G122 (= G124)
4gkmA Bianthranilate-like analogue bound in the outer site of anthranilate phosphoribosyltransferase (anprt; trpd) (see paper)
35% identity, 72% coverage: 20:258/332 of query aligns to 16:255/346 of 4gkmA
- active site: V82 (≠ C84)
- binding 2-[(2-carboxyphenyl)amino]-5-methylbenzoic acid: N114 (= N116), A155 (= A157), P156 (= P158), Y162 (≠ M164), R163 (≠ K165), A166 (≠ G168), R169 (= R171), R170 (= R172)
- binding magnesium ion: S95 (= S97), D227 (= D230), E228 (= E231), E228 (= E231)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G86 (= G88), N93 (= N95), S95 (= S97), T96 (≠ S98), K111 (= K113), A117 (≠ M119), S118 (= S120), S119 (≠ G121), G122 (= G124)
3r6cA Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor acs179) (see paper)
35% identity, 72% coverage: 20:258/332 of query aligns to 16:255/346 of 3r6cA
- active site: V82 (≠ C84)
- binding 8-methoxyphenanthro[3,4-d][1,3]dioxole-5,6-dicarboxylic acid: M62 (= M66), N114 (= N116), A155 (= A157), P156 (= P158), H159 (= H161), Y162 (≠ M164), A166 (≠ G168), R169 (= R171), G182 (= G184), T185 (≠ S187), R239 (≠ V242), A241 (≠ K244), D246 (≠ R249)
- binding magnesium ion: S95 (= S97), D227 (= D230), E228 (= E231), E228 (= E231)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G85), G85 (= G87), G86 (= G88), N93 (= N95), S95 (= S97), T96 (≠ S98), K111 (= K113), N114 (= N116), R115 (= R117), A116 (= A118), A117 (≠ M119), S118 (= S120), S119 (≠ G121), G122 (= G124), G123 (≠ S125)
Sites not aligning to the query:
3qsaA Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor tamu-a7)
35% identity, 72% coverage: 20:258/332 of query aligns to 16:255/346 of 3qsaA
- active site: V82 (≠ C84)
- binding magnesium ion: S95 (= S97), D227 (= D230), E228 (= E231), E228 (= E231)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G85), G86 (= G88), N93 (= N95), S95 (= S97), T96 (≠ S98), K111 (= K113), A117 (≠ M119), S118 (= S120), S119 (≠ G121), G122 (= G124)
- binding 4,4,4-trifluoro-1-(4-methoxyphenyl)butane-1,3-dione: M62 (= M66), N114 (= N116), A155 (= A157), P156 (= P158), H159 (= H161), Y162 (≠ M164), R163 (≠ K165), A166 (≠ G168), G182 (= G184)
3qs8A Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor acs174) (see paper)
35% identity, 72% coverage: 20:258/332 of query aligns to 16:255/346 of 3qs8A
- active site: V82 (≠ C84)
- binding 2-benzylbenzoic acid: M62 (= M66), G83 (= G85), N114 (= N116), N114 (= N116), A155 (= A157), A155 (= A157), P156 (= P158), Y162 (≠ M164), Y162 (≠ M164), A166 (≠ G168), R169 (= R171), R169 (= R171), R170 (= R172), L181 (= L183), G182 (= G184)
- binding magnesium ion: S95 (= S97), D227 (= D230), E228 (= E231), E228 (= E231)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G85), G85 (= G87), G86 (= G88), N93 (= N95), S95 (= S97), T96 (≠ S98), K111 (= K113), N114 (= N116), A116 (= A118), A117 (≠ M119), S118 (= S120), S119 (≠ G121), G122 (= G124), E228 (= E231)
3qqsA Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor acs172) (see paper)
35% identity, 72% coverage: 20:258/332 of query aligns to 16:255/346 of 3qqsA
- active site: V82 (≠ C84)
- binding 2,2'-iminodibenzoic acid: P156 (= P158), H159 (= H161), Y162 (≠ M164), R163 (≠ K165), A166 (≠ G168), R169 (= R171), R170 (= R172)
- binding magnesium ion: S95 (= S97), D227 (= D230), E228 (= E231), E228 (= E231)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V82 (≠ C84), G85 (= G87), G86 (= G88), N93 (= N95), S95 (= S97), T96 (≠ S98), K111 (= K113), R115 (= R117), A117 (≠ M119), S118 (= S120), S119 (≠ G121), G122 (= G124)
1zvwA The crystal structure of trpd (rv2192c) from mycobacterium tuberculosis in complex with prpp and magnesium (see paper)
35% identity, 72% coverage: 20:258/332 of query aligns to 16:255/346 of 1zvwA
- active site: V82 (≠ C84)
- binding benzamidine: T46 (≠ R50), M47 (= M51), K48 (≠ R52), P50 (≠ E54), D201 (≠ E203)
- binding magnesium ion: S95 (= S97), D227 (= D230), E228 (= E231), E228 (= E231)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G85), N93 (= N95), S95 (= S97), T96 (≠ S98), A117 (≠ M119), S118 (= S120), S119 (≠ G121)
4n93A Alternative substrates of mycobacterium tuberculosis anthranilate phosphoribosyl transferase (see paper)
35% identity, 72% coverage: 20:258/332 of query aligns to 17:256/346 of 4n93A
- active site: V83 (≠ C84)
- binding 2-amino-6-methylbenzoic acid: V83 (≠ C84), G84 (= G85), T85 (= T86), H113 (= H114), N115 (= N116), N115 (= N116), A156 (= A157), P157 (= P158), H160 (= H161), Y163 (≠ M164), A167 (≠ G168), R170 (= R171), G183 (= G184), P184 (= P185)
- binding magnesium ion: S96 (= S97), D228 (= D230), E229 (= E231), E229 (= E231)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G84 (= G85), G86 (= G87), G87 (= G88), N94 (= N95), S96 (= S97), T97 (≠ S98), K112 (= K113), A117 (= A118), A118 (≠ M119), S120 (≠ G121), G123 (= G124)
3r88B Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor acs145) (see paper)
35% identity, 72% coverage: 20:258/332 of query aligns to 16:255/344 of 3r88B
- active site: V82 (≠ C84)
- binding 2-amino-4,5-dimethoxybenzoic acid: N114 (= N116), A155 (= A157), P156 (= P158), H159 (= H161), Y162 (≠ M164), R163 (≠ K165), A166 (≠ G168)
- binding magnesium ion: S95 (= S97), D227 (= D230), E228 (= E231), E228 (= E231)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V82 (≠ C84), G83 (= G85), G85 (= G87), G86 (= G88), N93 (= N95), S95 (= S97), T96 (≠ S98), K111 (= K113), N114 (= N116), A117 (≠ M119), S118 (= S120), S119 (≠ G121)
4giuA Bianthranilate-like analogue bound in inner site of anthranilate phosphoribosyltransferase (anprt; trpd). (see paper)
35% identity, 72% coverage: 20:258/332 of query aligns to 17:256/346 of 4giuA
- active site: V83 (≠ C84)
- binding 2-[(2-carboxy-5-methylphenyl)amino]-3-methylbenzoic acid: G114 (= G115), N115 (= N116), A156 (= A157), H160 (= H161), Y163 (≠ M164), R170 (= R171), G183 (= G184)
- binding magnesium ion: S96 (= S97), D228 (= D230), E229 (= E231), E229 (= E231)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G84 (= G85), G86 (= G87), G87 (= G88), N94 (= N95), S96 (= S97), T97 (≠ S98), K112 (= K113), N115 (= N116), A117 (= A118), A118 (≠ M119), S119 (= S120), S120 (≠ G121), G123 (= G124)
4owuA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 5-methylanthranilate, prpp and magnesium (see paper)
35% identity, 72% coverage: 20:258/332 of query aligns to 17:256/347 of 4owuA
- active site: V83 (≠ C84)
- binding 2-azanyl-5-methyl-benzoic acid: N115 (= N116), P157 (= P158), Y163 (≠ M164), R164 (≠ K165), A167 (≠ G168)
- binding magnesium ion: S96 (= S97), D228 (= D230), E229 (= E231), E229 (= E231)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G84 (= G85), G86 (= G87), G87 (= G88), N94 (= N95), S96 (= S97), T97 (≠ S98), K112 (= K113), A118 (≠ M119), S120 (≠ G121), G123 (= G124)
4owqA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 3-methylanthranilate, prpp and magnesium (see paper)
35% identity, 72% coverage: 20:258/332 of query aligns to 17:256/347 of 4owqA
- active site: V83 (≠ C84)
- binding 2-azanyl-3-methyl-benzoic acid: P157 (= P158), H160 (= H161), Y163 (≠ M164), A167 (≠ G168), R171 (= R172)
- binding magnesium ion: S96 (= S97), D228 (= D230), E229 (= E231), E229 (= E231)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V83 (≠ C84), G84 (= G85), G86 (= G87), G87 (= G88), N94 (= N95), S96 (= S97), T97 (≠ S98), K112 (= K113), A117 (= A118), A118 (≠ M119), S120 (≠ G121), G123 (= G124)
Query Sequence
>WP_083772354.1 NCBI__GCF_000025725.1:WP_083772354.1
MWGRGMKKELIRKTGMGEKLTQKETYTLFTSIMTGEMTESEIAAVLIAMRMRGETPDEIA
GAALAMNDVKVKFDTEGVKAYDTCGTGGSGKSTMNVSSAVAVLLASLGMPVVKHGNRAMS
GTMGSADLYEMAGVPIESAKDDMEAYFKKNNFAFCFAPLYHPAMKYAGPVRRQIMVPTIF
NFLGPLSNPADLAGQIIGIPKRERLAGIAEALEKMGRTNVALYSSLDGFDEASSCSETEV
YVIKEEGIRNFRIKPEQYFSVCDMPVVKTREEGLDMFVKAISPDGGKLNELIALNSGVAL
YVFDKADSLKDGYMKSMDTIQSGRVFEKYRGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory