Comparing WP_083780027.1 NCBI__GCF_000092905.1:WP_083780027.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7txsA X-ray structure of the viob n-aetyltransferase from acinetobacter baumannii in the presence of a reaction intermediate (see paper)
34% identity, 85% coverage: 34:251/257 of query aligns to 1:209/209 of 7txsA
7txqA X-ray structure of the viob n-acetyltransferase from acinetobacter baumannii in the present of tdp and acetyl-coenzymea (see paper)
34% identity, 85% coverage: 34:251/257 of query aligns to 1:209/209 of 7txqA
7txpA X-ray structure of the viob n-acetyltransferase from acinetobacter baumannii in complex with tdp-4-amino-4,6-dideoxy-d-glucose (see paper)
34% identity, 85% coverage: 34:251/257 of query aligns to 1:209/209 of 7txpA
4m99A Acetyltransferase domain of pglb from neisseria gonorrhoeae fa1090 in complex with acetyl coenzyme a (see paper)
32% identity, 83% coverage: 33:245/257 of query aligns to 1:204/206 of 4m99A
P71063 UDP-N-acetylbacillosamine N-acetyltransferase; EC 2.3.1.203 from Bacillus subtilis (strain 168) (see paper)
30% identity, 85% coverage: 34:251/257 of query aligns to 1:211/216 of P71063
7l7yAAA Putative acetyl transferase protein (see paper)
30% identity, 82% coverage: 35:246/257 of query aligns to 2:215/217 of 7l7yAAA
7l82AAA Putative acetyl transferase protein (see paper)
30% identity, 82% coverage: 35:246/257 of query aligns to 2:215/216 of 7l82AAA
7l81AAA Putative acetyl transferase protein (see paper)
30% identity, 82% coverage: 35:246/257 of query aligns to 2:215/216 of 7l81AAA
7l7zAAA Putative acetyl transferase protein (see paper)
30% identity, 82% coverage: 35:246/257 of query aligns to 2:215/216 of 7l7zAAA
5t2yA Crystal structure of c. Jejuni pgld in complex with 5-methyl-4- (methylamino)-2-phenethylthieno[2,3-d]pyrimidine-6-carboxylic acid (see paper)
27% identity, 82% coverage: 35:245/257 of query aligns to 4:190/192 of 5t2yA
4ea9A X-ray structure of gdp-perosamine n-acetyltransferase in complex with transition state analog at 0.9 angstrom resolution (see paper)
33% identity, 55% coverage: 106:247/257 of query aligns to 66:206/207 of 4ea9A
Sites not aligning to the query:
4ea8A X-ray crystal structure of perb from caulobacter crescentus in complex with coenzyme a and gdp-n-acetylperosamine at 1 angstrom resolution (see paper)
33% identity, 55% coverage: 106:247/257 of query aligns to 66:206/207 of 4ea8A
Sites not aligning to the query:
3bsyA Pgld from campylobacter jejuni, nctc 11168, in complex with acetyl coenzyme a (see paper)
30% identity, 54% coverage: 106:245/257 of query aligns to 51:191/193 of 3bsyA
5tyhA Pgld from campylobacter jejuni nctc 11168 in complex with 5-(2- furanyl)-1h-pyrazole-3-carboxylic acid (see paper)
30% identity, 54% coverage: 106:245/257 of query aligns to 43:183/185 of 5tyhA
3bssA Pgld from campylobacter jejuni, nctc 11168, with native substrate (see paper)
30% identity, 54% coverage: 106:245/257 of query aligns to 52:192/194 of 3bssA
Sites not aligning to the query:
2vheA Pgld-coa complex: an acetyl transferase from campylobacter jejuni (see paper)
30% identity, 54% coverage: 106:245/257 of query aligns to 52:192/194 of 2vheA
Sites not aligning to the query:
Q0P9D1 UDP-N-acetylbacillosamine N-acetyltransferase; Protein glycosylation D; UDP-4-amino-4,6-dideoxy-N-acetyl-alpha-D-glucosamine N-acetyltransferase; EC 2.3.1.203 from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) (see 2 papers)
30% identity, 54% coverage: 106:245/257 of query aligns to 53:193/195 of Q0P9D1
Sites not aligning to the query:
4eaaA X-ray crystal structure of the h141n mutant of perosamine n- acetyltransferase from caulobacter crescentus in complex with coa and gdp-perosamine (see paper)
31% identity, 66% coverage: 79:247/257 of query aligns to 43:208/210 of 4eaaA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 48% coverage: 127:250/257 of query aligns to 80:185/203 of P07464
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
31% identity, 48% coverage: 127:250/257 of query aligns to 79:184/200 of 1krrA
>WP_083780027.1 NCBI__GCF_000092905.1:WP_083780027.1
MACTPTRKNSCWAGKVWWRGVNIGEVEGAEEKGIRPLVIVGAGGMGRETAWLVERINARK
PTWNILGFVDDRRPDESLLLGYPYLGPVRSSLNKIIHEGIRPAVSVAIGDSKARFGVVSG
LFNMGIRSFPALIDPDIDVHRSVNIGEGSIICPGVILTVNVVIGKFVIVNVASSISHESK
LGDFSSVMTGVRISGNCRIGHGAYIGSGAVVLQGRAVGEAAVVGAGAVVTRDVEPRVVSV
GIPARIQRWIEVKPDDR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory