SitesBLAST
Comparing WP_083866922.1 NCBI__GCF_000058485.1:WP_083866922.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
46% identity, 92% coverage: 33:601/621 of query aligns to 93:654/664 of P09114
- P191 (≠ A131) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W510) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
46% identity, 92% coverage: 33:601/621 of query aligns to 96:657/667 of P09342
- C161 (= C98) modified: Disulfide link with 307
- P194 (≠ A131) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ V246) modified: Disulfide link with 161
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
45% identity, 92% coverage: 33:601/621 of query aligns to 13:574/582 of 3ea4A
- active site: Y32 (≠ I52), G34 (= G54), G35 (= G55), A36 (= A56), S37 (≠ I57), E58 (= E78), T81 (= T101), F120 (= F140), Q121 (= Q141), E122 (= E142), K170 (= K190), M265 (= M289), V292 (= V316), V399 (= V421), G425 (= G447), M427 (= M449), D452 (= D474), N479 (= N501), H481 (≠ S503), L482 (= L504), M484 (= M506), V485 (= V507), W488 (= W510), H557 (≠ P584)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D314), R291 (= R315), W488 (= W510), S567 (≠ A594)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R180), G221 (= G243), G222 (= G244), G223 (= G245), T245 (= T269), L246 (= L270), M247 (= M271), L263 (≠ P287), G264 (= G288), M265 (= M289), H266 (= H290), G285 (= G309), R287 (= R311), D289 (= D313), R291 (= R315), D309 (= D333), I310 (= I334), G327 (= G351), D328 (= D352), V329 (≠ C353), M404 (= M426), G422 (= G444)
- binding magnesium ion: D452 (= D474), N479 (= N501), H481 (≠ S503)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V421), G400 (= G422), Q401 (= Q423), H402 (= H424), M427 (= M449), G451 (= G473), D452 (= D474), G453 (= G475), S454 (≠ C476), N479 (= N501), H481 (≠ S503), L482 (= L504), G483 (= G505), M484 (= M506), V485 (= V507)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
45% identity, 92% coverage: 33:601/621 of query aligns to 13:574/582 of 3e9yA
- active site: Y32 (≠ I52), G34 (= G54), G35 (= G55), A36 (= A56), S37 (≠ I57), E58 (= E78), T81 (= T101), F120 (= F140), Q121 (= Q141), E122 (= E142), K170 (= K190), M265 (= M289), V292 (= V316), V399 (= V421), G425 (= G447), M427 (= M449), D452 (= D474), N479 (= N501), H481 (≠ S503), L482 (= L504), M484 (= M506), V485 (= V507), W488 (= W510), H557 (≠ P584)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D314), R291 (= R315), W488 (= W510), S567 (≠ A594)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R180), G221 (= G243), G222 (= G244), G223 (= G245), T245 (= T269), L246 (= L270), M247 (= M271), L263 (≠ P287), G285 (= G309), R287 (= R311), D289 (= D313), R291 (= R315), D309 (= D333), I310 (= I334), G327 (= G351), D328 (= D352), V329 (≠ C353), M404 (= M426), G422 (= G444)
- binding magnesium ion: D452 (= D474), N479 (= N501), H481 (≠ S503)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V421), G400 (= G422), Q401 (= Q423), H402 (= H424), M427 (= M449), G451 (= G473), G453 (= G475), S454 (≠ C476), N479 (= N501), H481 (≠ S503), L482 (= L504), G483 (= G505), M484 (= M506), V485 (= V507)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
45% identity, 92% coverage: 33:601/621 of query aligns to 14:575/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (= M289), R292 (= R315), W489 (= W510), S568 (≠ A594)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V421), G401 (= G422), Q402 (= Q423), H403 (= H424), G426 (= G447), M428 (= M449), G452 (= G473), D453 (= D474), G454 (= G475), S455 (≠ C476), L483 (= L504), G484 (= G505), M485 (= M506), V486 (= V507)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G243), G223 (= G244), G224 (= G245), T246 (= T269), L247 (= L270), M248 (= M271), M263 (= M286), L264 (≠ P287), M266 (= M289), H267 (= H290), G286 (= G309), R288 (= R311), V293 (= V316), D310 (= D333), I311 (= I334), D329 (= D352), V330 (≠ C353), M405 (= M426), G423 (= G444)
- binding magnesium ion: A37 (= A56), T82 (= T101), S83 (= S102), Q122 (= Q141), Y381 (≠ H402), D453 (= D474), M458 (= M479), Q461 (= Q482), N480 (= N501), H482 (≠ S503), K533 (≠ A558)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
45% identity, 92% coverage: 33:601/621 of query aligns to 99:660/670 of P17597
- A122 (= A56) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ L58) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E78) binding
- S186 (= S120) binding
- P197 (≠ A131) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ A133) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q141) binding
- K220 (= K154) binding
- R246 (= R180) binding ; binding
- K256 (= K190) binding
- G308 (= G244) binding
- TL 331:332 (= TL 269:270) binding
- C340 (≠ D278) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (≠ PGMH 287:290) binding
- GVRFD 371:375 (≠ GARFD 309:313) binding
- DR 376:377 (= DR 314:315) binding
- DI 395:396 (= DI 333:334) binding
- DV 414:415 (≠ DC 352:353) binding
- QH 487:488 (= QH 423:424) binding
- GG 508:509 (= GG 444:445) binding
- GAM 511:513 (≠ GTM 447:449) binding
- D538 (= D474) binding
- DGS 538:540 (≠ DGC 474:476) binding
- N565 (= N501) binding
- NQHLGM 565:570 (≠ NGSLGM 501:506) binding
- H567 (≠ S503) binding
- W574 (= W510) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ A594) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
45% identity, 92% coverage: 33:601/621 of query aligns to 14:575/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V421), G401 (= G422), Q402 (= Q423), H403 (= H424), G426 (= G447), M428 (= M449), G452 (= G473), D453 (= D474), G454 (= G475), S455 (≠ C476), M458 (= M479), N480 (= N501), H482 (≠ S503), L483 (= L504), G484 (= G505), M485 (= M506), V486 (= V507)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G243), G223 (= G244), G224 (= G245), T246 (= T269), L247 (= L270), M248 (= M271), L264 (≠ P287), M266 (= M289), H267 (= H290), G286 (= G309), V287 (≠ A310), R288 (= R311), D290 (= D313), R292 (= R315), V293 (= V316), D310 (= D333), I311 (= I334), D329 (= D352), V330 (≠ C353), M405 (= M426), G423 (= G444)
- binding magnesium ion: F370 (≠ Y390), D453 (= D474), M458 (= M479), Q461 (= Q482), N480 (= N501), H482 (≠ S503), K533 (≠ A558)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M289), R292 (= R315), M485 (= M506), W489 (= W510), S568 (≠ A594)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
45% identity, 92% coverage: 33:601/621 of query aligns to 14:575/582 of 5wj1A
- active site: Y33 (≠ I52), G35 (= G54), G36 (= G55), A37 (= A56), S38 (≠ I57), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M289), V293 (= V316), V400 (= V421), G426 (= G447), M428 (= M449), D453 (= D474), N480 (= N501), H482 (≠ S503), L483 (= L504), M485 (= M506), V486 (= V507), W489 (= W510), H558 (≠ P584)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G243), G223 (= G244), G224 (= G245), T246 (= T269), L247 (= L270), M248 (= M271), M263 (= M286), L264 (≠ P287), G286 (= G309), R288 (= R311), V293 (= V316), D310 (= D333), I311 (= I334), D329 (= D352), V330 (≠ C353), M405 (= M426), G423 (= G444), G424 (= G445)
- binding magnesium ion: D453 (= D474), N480 (= N501), H482 (≠ S503)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M289), D291 (= D314), R292 (= R315), M485 (= M506), W489 (= W510), S568 (≠ A594)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V421), G401 (= G422), Q402 (= Q423), H403 (= H424), M428 (= M449), D453 (= D474), G454 (= G475), S455 (≠ C476), M458 (= M479), N480 (= N501), H482 (≠ S503), L483 (= L504), G484 (= G505), M485 (= M506), V486 (= V507)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
45% identity, 92% coverage: 33:601/621 of query aligns to 14:575/582 of 5k6tA
- active site: Y33 (≠ I52), G35 (= G54), G36 (= G55), A37 (= A56), S38 (≠ I57), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M289), V293 (= V316), V400 (= V421), G426 (= G447), M428 (= M449), D453 (= D474), N480 (= N501), H482 (≠ S503), L483 (= L504), M485 (= M506), V486 (= V507), W489 (= W510), H558 (≠ P584)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H290), R292 (= R315), M485 (= M506), W489 (= W510), S568 (≠ A594)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G243), G223 (= G244), G224 (= G245), T246 (= T269), L247 (= L270), M248 (= M271), L264 (≠ P287), G286 (= G309), R288 (= R311), D290 (= D313), R292 (= R315), V293 (= V316), D310 (= D333), I311 (= I334), D329 (= D352), V330 (≠ C353), Q404 (= Q425), M405 (= M426), G423 (= G444)
- binding magnesium ion: D453 (= D474), N480 (= N501), H482 (≠ S503)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V421), G401 (= G422), Q402 (= Q423), H403 (= H424), G426 (= G447), M428 (= M449), G452 (= G473), G454 (= G475), S455 (≠ C476), N480 (= N501), H482 (≠ S503), L483 (= L504), G484 (= G505)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
45% identity, 92% coverage: 33:601/621 of query aligns to 14:575/582 of 5k6rA
- active site: Y33 (≠ I52), G35 (= G54), G36 (= G55), A37 (= A56), S38 (≠ I57), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M289), V293 (= V316), V400 (= V421), G426 (= G447), M428 (= M449), D453 (= D474), N480 (= N501), H482 (≠ S503), L483 (= L504), M485 (= M506), V486 (= V507), W489 (= W510), H558 (≠ P584)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R315), W489 (= W510), S568 (≠ A594)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G243), G223 (= G244), G224 (= G245), T246 (= T269), L247 (= L270), M248 (= M271), L264 (≠ P287), M266 (= M289), G286 (= G309), R288 (= R311), R292 (= R315), V293 (= V316), D310 (= D333), I311 (= I334), G328 (= G351), D329 (= D352), V330 (≠ C353), M405 (= M426), G423 (= G444)
- binding magnesium ion: D453 (= D474), N480 (= N501), H482 (≠ S503)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V421), G401 (= G422), Q402 (= Q423), H403 (= H424), G426 (= G447), M428 (= M449), D453 (= D474), G454 (= G475), S455 (≠ C476), M458 (= M479), N480 (= N501), H482 (≠ S503), L483 (= L504), G484 (= G505), M485 (= M506), V486 (= V507)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
45% identity, 92% coverage: 33:601/621 of query aligns to 14:575/582 of 1z8nA
- active site: Y33 (≠ I52), G35 (= G54), G36 (= G55), A37 (= A56), S38 (≠ I57), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M289), V293 (= V316), V400 (= V421), G426 (= G447), M428 (= M449), D453 (= D474), N480 (= N501), H482 (≠ S503), L483 (= L504), M485 (= M506), V486 (= V507), W489 (= W510), H558 (≠ P584)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K154), R161 (= R180), Y191 (= Y214), R194 (= R215), D291 (= D314), R292 (= R315), D312 (= D335), W489 (= W510), G569 (= G595)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G243), G224 (= G245), T246 (= T269), L247 (= L270), M248 (= M271), L264 (≠ P287), G265 (= G288), M266 (= M289), H267 (= H290), G286 (= G309), V287 (≠ A310), R288 (= R311), D290 (= D313), R292 (= R315), V293 (= V316), D310 (= D333), I311 (= I334), D329 (= D352), V330 (≠ C353), M405 (= M426), G423 (= G444), G424 (= G445)
- binding magnesium ion: D453 (= D474), N480 (= N501)
- binding thiamine diphosphate: V400 (= V421), G401 (= G422), Q402 (= Q423), H403 (= H424), G426 (= G447), M428 (= M449), G452 (= G473), G454 (= G475), S455 (≠ C476), N480 (= N501), H482 (≠ S503), L483 (= L504), G484 (= G505), M485 (= M506), V486 (= V507)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
45% identity, 92% coverage: 33:601/621 of query aligns to 14:575/582 of 1yi1A
- active site: Y33 (≠ I52), G35 (= G54), G36 (= G55), A37 (= A56), S38 (≠ I57), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M289), V293 (= V316), V400 (= V421), G426 (= G447), M428 (= M449), D453 (= D474), N480 (= N501), H482 (≠ S503), L483 (= L504), M485 (= M506), V486 (= V507), W489 (= W510), H558 (≠ P584)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D314), R292 (= R315), W489 (= W510), S568 (≠ A594)
- binding flavin-adenine dinucleotide: R161 (= R180), G223 (= G244), G224 (= G245), T246 (= T269), L247 (= L270), M248 (= M271), M263 (= M286), L264 (≠ P287), G265 (= G288), M266 (= M289), H267 (= H290), G286 (= G309), V287 (≠ A310), R288 (= R311), D290 (= D313), V293 (= V316), D310 (= D333), I311 (= I334), D329 (= D352), V330 (≠ C353), M405 (= M426), G423 (= G444), G424 (= G445)
- binding magnesium ion: D453 (= D474), N480 (= N501), H482 (≠ S503)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
45% identity, 92% coverage: 33:601/621 of query aligns to 14:575/582 of 1yi0A
- active site: Y33 (≠ I52), G35 (= G54), G36 (= G55), A37 (= A56), S38 (≠ I57), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M289), V293 (= V316), V400 (= V421), G426 (= G447), M428 (= M449), D453 (= D474), N480 (= N501), H482 (≠ S503), L483 (= L504), M485 (= M506), V486 (= V507), W489 (= W510), H558 (≠ P584)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D314), R292 (= R315), W489 (= W510), S568 (≠ A594)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G243), G223 (= G244), G224 (= G245), T246 (= T269), L247 (= L270), M248 (= M271), L264 (≠ P287), G265 (= G288), M266 (= M289), H267 (= H290), G286 (= G309), V287 (≠ A310), R288 (= R311), D290 (= D313), R292 (= R315), V293 (= V316), D310 (= D333), I311 (= I334), G328 (= G351), D329 (= D352), V330 (≠ C353), M405 (= M426), G423 (= G444), G424 (= G445)
- binding magnesium ion: D453 (= D474), N480 (= N501), H482 (≠ S503)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
45% identity, 92% coverage: 33:601/621 of query aligns to 14:575/582 of 1yhzA
- active site: Y33 (≠ I52), G35 (= G54), G36 (= G55), A37 (= A56), S38 (≠ I57), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M289), V293 (= V316), V400 (= V421), G426 (= G447), M428 (= M449), D453 (= D474), N480 (= N501), H482 (≠ S503), L483 (= L504), M485 (= M506), V486 (= V507), W489 (= W510), H558 (≠ P584)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D314), R292 (= R315), M485 (= M506), W489 (= W510), S568 (≠ A594)
- binding flavin-adenine dinucleotide: R161 (= R180), G223 (= G244), G224 (= G245), T246 (= T269), L247 (= L270), M248 (= M271), L264 (≠ P287), M266 (= M289), H267 (= H290), G286 (= G309), V287 (≠ A310), R288 (= R311), D290 (= D313), V293 (= V316), D310 (= D333), I311 (= I334), D329 (= D352), V330 (≠ C353), Q404 (= Q425), M405 (= M426), G423 (= G444), G424 (= G445)
- binding magnesium ion: D453 (= D474), N480 (= N501), H482 (≠ S503)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
45% identity, 92% coverage: 33:601/621 of query aligns to 14:575/582 of 1yhyA
- active site: Y33 (≠ I52), G35 (= G54), G36 (= G55), A37 (= A56), S38 (≠ I57), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M289), V293 (= V316), V400 (= V421), G426 (= G447), M428 (= M449), D453 (= D474), N480 (= N501), H482 (≠ S503), L483 (= L504), M485 (= M506), V486 (= V507), W489 (= W510), H558 (≠ P584)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D314), R292 (= R315), V486 (= V507), W489 (= W510), S568 (≠ A594)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G243), G223 (= G244), G224 (= G245), T246 (= T269), L247 (= L270), M248 (= M271), L264 (≠ P287), G265 (= G288), M266 (= M289), H267 (= H290), G286 (= G309), V287 (≠ A310), R288 (= R311), D290 (= D313), V293 (= V316), D310 (= D333), I311 (= I334), D329 (= D352), V330 (≠ C353), Q404 (= Q425), M405 (= M426), G423 (= G444), G424 (= G445)
- binding magnesium ion: D453 (= D474), N480 (= N501), H482 (≠ S503)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
45% identity, 92% coverage: 33:601/621 of query aligns to 14:575/582 of 1ybhA
- active site: Y33 (≠ I52), G35 (= G54), G36 (= G55), A37 (= A56), S38 (≠ I57), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M289), V293 (= V316), V400 (= V421), G426 (= G447), M428 (= M449), D453 (= D474), N480 (= N501), H482 (≠ S503), L483 (= L504), M485 (= M506), V486 (= V507), W489 (= W510), H558 (≠ P584)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (= M289), D291 (= D314), R292 (= R315), M485 (= M506), W489 (= W510), S568 (≠ A594)
- binding flavin-adenine dinucleotide: R161 (= R180), G223 (= G244), G224 (= G245), T246 (= T269), L247 (= L270), M248 (= M271), L264 (≠ P287), M266 (= M289), H267 (= H290), G286 (= G309), V287 (≠ A310), R288 (= R311), D290 (= D313), V293 (= V316), D310 (= D333), I311 (= I334), D329 (= D352), V330 (≠ C353), Q404 (= Q425), M405 (= M426), G423 (= G444), G424 (= G445)
- binding magnesium ion: D453 (= D474), N480 (= N501), H482 (≠ S503)
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
45% identity, 92% coverage: 33:601/621 of query aligns to 14:575/583 of 5k3sA
- active site: Y33 (≠ I52), G35 (= G54), G36 (= G55), A37 (= A56), S38 (≠ I57), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M289), V293 (= V316), V400 (= V421), G426 (= G447), M428 (= M449), D453 (= D474), N480 (= N501), H482 (≠ S503), L483 (= L504), M485 (= M506), V486 (= V507), W489 (= W510), H558 (≠ P584)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R315), M485 (= M506), W489 (= W510), G569 (= G595)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G243), G223 (= G244), G224 (= G245), T246 (= T269), L247 (= L270), M248 (= M271), L264 (≠ P287), M266 (= M289), G286 (= G309), R288 (= R311), D290 (= D313), V293 (= V316), D310 (= D333), I311 (= I334), D329 (= D352), V330 (≠ C353), M405 (= M426), G423 (= G444)
- binding magnesium ion: D453 (= D474), N480 (= N501), H482 (≠ S503)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V421), G401 (= G422), Q402 (= Q423), H403 (= H424), G426 (= G447), M428 (= M449), D453 (= D474), G454 (= G475), S455 (≠ C476), N480 (= N501), H482 (≠ S503), L483 (= L504), G484 (= G505), M485 (= M506), V486 (= V507)
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
45% identity, 92% coverage: 33:601/621 of query aligns to 14:575/585 of 5k2oA
- active site: Y33 (≠ I52), G35 (= G54), G36 (= G55), A37 (= A56), S38 (≠ I57), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M289), V293 (= V316), V400 (= V421), G426 (= G447), M428 (= M449), D453 (= D474), N480 (= N501), H482 (≠ S503), L483 (= L504), M485 (= M506), V486 (= V507), W489 (= W510), H558 (≠ P584)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M289), R292 (= R315), W489 (= W510), S568 (≠ A594)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G243), G223 (= G244), G224 (= G245), T246 (= T269), L247 (= L270), M248 (= M271), L264 (≠ P287), G286 (= G309), R288 (= R311), D290 (= D313), V293 (= V316), D310 (= D333), I311 (= I334), D329 (= D352), V330 (≠ C353), Q404 (= Q425), M405 (= M426), G423 (= G444)
- binding magnesium ion: D453 (= D474), N480 (= N501), H482 (≠ S503)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V421), G401 (= G422), Q402 (= Q423), H403 (= H424), M428 (= M449), D453 (= D474), G454 (= G475), S455 (≠ C476), N480 (= N501), H482 (≠ S503), L483 (= L504), G484 (= G505), M485 (= M506), V486 (= V507)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
43% identity, 92% coverage: 31:601/621 of query aligns to 8:573/596 of 1t9cA
- active site: Y29 (≠ I52), G31 (= G54), G32 (= G55), A33 (= A56), I34 (= I57), E55 (= E78), T78 (= T101), F117 (= F140), Q118 (= Q141), E119 (= E142), K167 (= K190), R227 (≠ A253), M263 (= M289), V290 (= V316), V406 (= V421), L431 (≠ A446), G432 (= G447), M434 (= M449), D459 (= D474), N486 (= N501), E488 (≠ S503), Q489 (≠ L504), M491 (= M506), V492 (= V507), W495 (= W510), L517 (= L544), G522 (= G549), L523 (≠ C550), K556 (≠ P584)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G55), V107 (= V130), P108 (≠ A131), F117 (= F140), K167 (= K190), D288 (= D314), R289 (= R315), W495 (= W510)
- binding flavin-adenine dinucleotide: R157 (= R180), G216 (= G243), A217 (≠ G244), G218 (= G245), N221 (≠ K248), T243 (= T269), L244 (= L270), Q245 (≠ M271), L261 (≠ P287), M263 (= M289), H264 (= H290), G283 (= G309), A284 (= A310), R285 (= R311), D287 (= D313), R289 (= R315), V290 (= V316), E316 (≠ D333), V317 (≠ I334), N321 (≠ E338), G334 (= G351), D335 (= D352), A336 (≠ C353), M411 (= M426), G429 (= G444), G430 (= G445)
- binding magnesium ion: D459 (= D474), N486 (= N501), E488 (≠ S503)
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
43% identity, 92% coverage: 31:601/621 of query aligns to 9:574/597 of 1t9aA
- active site: Y30 (≠ I52), G32 (= G54), G33 (= G55), A34 (= A56), I35 (= I57), E56 (= E78), T79 (= T101), F118 (= F140), Q119 (= Q141), E120 (= E142), K168 (= K190), R228 (≠ A253), M264 (= M289), V291 (= V316), V407 (= V421), L432 (≠ A446), G433 (= G447), M435 (= M449), D460 (= D474), N487 (= N501), E489 (≠ S503), Q490 (≠ L504), M492 (= M506), V493 (= V507), W496 (= W510), L518 (= L544), G523 (= G549), L524 (≠ C550), K557 (≠ P584)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (= G55), V108 (= V130), P109 (≠ A131), F118 (= F140), K168 (= K190), M264 (= M289), D289 (= D314), R290 (= R315), M492 (= M506), V493 (= V507), W496 (= W510)
- binding flavin-adenine dinucleotide: R158 (= R180), G217 (= G243), A218 (≠ G244), G219 (= G245), N222 (≠ K248), T244 (= T269), L245 (= L270), Q246 (≠ M271), L262 (≠ P287), M264 (= M289), H265 (= H290), G284 (= G309), A285 (= A310), R286 (= R311), D288 (= D313), R290 (= R315), V291 (= V316), E317 (≠ D333), V318 (≠ I334), N322 (≠ E338), G335 (= G351), D336 (= D352), A337 (≠ C353), Q411 (= Q425), M412 (= M426), G430 (= G444), G431 (= G445)
- binding magnesium ion: D460 (= D474), N487 (= N501), E489 (≠ S503)
- binding propyl trihydrogen diphosphate: V407 (= V421), G408 (= G422), Q409 (= Q423), H410 (= H424), M435 (= M449), G459 (= G473), D460 (= D474), A461 (≠ G475), S462 (≠ C476), N487 (= N501), E489 (≠ S503), Q490 (≠ L504), G491 (= G505), M492 (= M506)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (= G447), M435 (= M449), M465 (= M479)
Query Sequence
>WP_083866922.1 NCBI__GCF_000058485.1:WP_083866922.1
MARAPAFRPPRPPAVADSRPVKEDAQMTREITGAQSLVHSLEAVGADVVFGIPGGAILPA
YDPLFDSTRVRHILVRHEQGAGHAAEGYAQATGRVGVCMATSGPGATNLVTPIADAYMDS
VPMVAITGQVASAAIGTDAFQEADICGITLPITKHNFLVQSVDDIPRTIAEAFHLAGTGR
PGPVLVDLPKDILQSVTSVLPHEIWPPTLDLPGYRPITRPHNKQVREAAKLISASRRPVL
YIGGGVLKARAAAELRTLAEMTGIPVVTTLMARGAFPDSHPQHLGMPGMHGSVAAVTALQ
KADLLITLGARFDDRVTGRLASFAPKAAIIHADIDPAEIGKNRTADVPIVGDCREVINEL
IAALAAEPRPELDAWWHTLDGWRRTYPLGYDTPADGSLAPQHVIERLGRISGPETIFAAG
VGQHQMWAAQFISYEHPYTWLNSGGAGTMGFAVPAAMGAKVGRPDTTVWAIDGDGCFQMT
NQELATCALEGIPIKVAVINNGSLGMVRQWQTLFYDKRYSNTELGTHPGSPRTGVKRVPD
FVRLAEALGCVGLRCDSAAEVDATIEKAMAIDDAPVVVDFVVHPDAMVWPMVAAGASNDE
IRVARDLAPDFDYSGDAEVNL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory