SitesBLAST
Comparing WP_083931526.1 NCBI__GCF_000385335.1:WP_083931526.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
58% identity, 100% coverage: 1:416/417 of query aligns to 30:447/455 of Q9R4E4
- R33 (= R4) binding
- NAAT 98:101 (≠ NAGT 70:73) Phosphoenolpyruvate
- A100 (≠ G72) mutation to G: Confers resistance to glyphosate.
- R128 (= R100) binding
- K353 (= K326) binding
- R357 (= R330) binding
- R405 (= R374) binding
Sites not aligning to the query:
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
58% identity, 100% coverage: 1:416/417 of query aligns to 25:442/445 of 2pqcA
- active site: D50 (= D26), N93 (= N70), R123 (= R100), D321 (= D299), E349 (= E327), H399 (= H373), R400 (= R374), T426 (= T400)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: R28 (= R4), T96 (= T73), R123 (= R100), S168 (= S146), Q170 (= Q148), D321 (= D299), K348 (= K326), E349 (= E327), R352 (= R330), R400 (= R374)
Sites not aligning to the query:
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
58% identity, 100% coverage: 1:416/417 of query aligns to 25:442/445 of 2pqbA
- active site: D50 (= D26), N93 (= N70), R123 (= R100), D321 (= D299), E349 (= E327), H399 (= H373), R400 (= R374), T426 (= T400)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: R28 (= R4), A95 (≠ G72), T96 (= T73), R123 (= R100), S168 (= S146), Q170 (= Q148), D321 (= D299), K348 (= K326), E349 (= E327), R352 (= R330), R400 (= R374)
Sites not aligning to the query:
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
58% identity, 100% coverage: 1:416/417 of query aligns to 25:442/445 of 2ggaA
- active site: D50 (= D26), N93 (= N70), R123 (= R100), D321 (= D299), E349 (= E327), H399 (= H373), R400 (= R374), T426 (= T400)
- binding glyphosate: A94 (= A71), A95 (≠ G72), T96 (= T73), R123 (= R100), D321 (= D299), E349 (= E327), R352 (= R330), R400 (= R374)
- binding shikimate-3-phosphate: R28 (= R4), S168 (= S146), A169 (= A147), Q170 (= Q148), R195 (= R173), D321 (= D299), K348 (= K326)
Sites not aligning to the query:
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
58% identity, 100% coverage: 1:416/417 of query aligns to 25:442/445 of 2gg6A
- active site: D50 (= D26), N93 (= N70), R123 (= R100), D321 (= D299), E349 (= E327), H399 (= H373), R400 (= R374), T426 (= T400)
- binding shikimate-3-phosphate: R28 (= R4), T96 (= T73), S168 (= S146), Q170 (= Q148), D321 (= D299), K348 (= K326)
Sites not aligning to the query:
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
41% identity, 99% coverage: 1:413/417 of query aligns to 23:426/438 of Q83E11
- R26 (= R4) binding
- NSGT 93:96 (≠ NAGT 70:73) Phosphoenolpyruvate
- R123 (= R100) binding
- D315 (= D299) active site, Proton acceptor
- K342 (= K326) binding
- R346 (= R330) binding
- R387 (= R374) binding
Sites not aligning to the query:
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
41% identity, 99% coverage: 1:413/417 of query aligns to 25:428/440 of 3slhD
- active site: D50 (= D26), N95 (= N70), R125 (= R100), D317 (= D299), E345 (= E327), H388 (= H373), R389 (= R374), T415 (= T400)
- binding glyphosate: G97 (= G72), T98 (= T73), R125 (= R100), Q171 (= Q148), D317 (= D299), E345 (= E327), R348 (= R330), H388 (= H373), R389 (= R374)
- binding shikimate-3-phosphate: R28 (= R4), S169 (= S146), Q171 (= Q148), R196 (= R173), D317 (= D299), K344 (= K326)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: R28 (= R4), T98 (= T73), Q171 (= Q148), R196 (= R173), D317 (= D299), K344 (= K326)
Sites not aligning to the query:
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
41% identity, 99% coverage: 1:413/417 of query aligns to 25:424/434 of 4egrA
- active site: D50 (= D26), N95 (= N70), R125 (= R100), D313 (= D299), E341 (= E327), H384 (= H373), R385 (= R374), T411 (= T400)
- binding phosphoenolpyruvate: G97 (= G72), T98 (= T73), R125 (= R100), D313 (= D299), E341 (= E327), R344 (= R330), R385 (= R374)
Sites not aligning to the query:
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
39% identity, 99% coverage: 1:412/417 of query aligns to 22:424/427 of 1rf6A
- active site: D47 (= D26), N90 (= N70), D115 (≠ S95), R120 (= R100), D312 (= D299), E340 (= E327), H384 (= H373), R385 (= R374), T412 (= T400)
- binding glyphosate: G92 (= G72), T93 (= T73), R120 (= R100), Q168 (= Q148), D312 (= D299), E340 (= E327), R343 (= R330), H384 (= H373), R385 (= R374)
- binding shikimate-3-phosphate: R25 (= R4), S166 (= S146), Q168 (= Q148), R193 (= R173), I311 (= I298), D312 (= D299), K339 (= K326)
Sites not aligning to the query:
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
39% identity, 99% coverage: 1:412/417 of query aligns to 22:424/427 of 1rf4A
- active site: D47 (= D26), N90 (= N70), D115 (≠ S95), R120 (= R100), D312 (= D299), E340 (= E327), H384 (= H373), R385 (= R374), T412 (= T400)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: R25 (= R4), G92 (= G72), T93 (= T73), R120 (= R100), S166 (= S146), A167 (= A147), Q168 (= Q148), R193 (= R173), D312 (= D299), K339 (= K326), E340 (= E327), R343 (= R330), H384 (= H373), R385 (= R374)
Sites not aligning to the query:
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
38% identity, 99% coverage: 1:412/417 of query aligns to 22:424/427 of Q9S400
- R25 (= R4) binding
- K339 (= K326) binding
Sites not aligning to the query:
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
28% identity, 97% coverage: 1:405/417 of query aligns to 24:417/426 of 3nvsA
- active site: D49 (= D26), N94 (= N70), P119 (≠ S95), R124 (= R100), H128 (≠ R104), Q135 (≠ L111), Y142 (≠ S118), E144 (≠ A120), A247 (= A221), A255 (≠ L229), D314 (= D299), E342 (= E327), H386 (= H373), R387 (= R374), K412 (≠ T400)
- binding glyphosate: G96 (= G72), R124 (= R100), Q172 (= Q148), D314 (= D299), E342 (= E327), R345 (= R330), H386 (= H373), R387 (= R374)
- binding magnesium ion: E123 (≠ K99), Q145 (≠ P121)
- binding shikimate-3-phosphate: R27 (= R4), T97 (= T73), S170 (= S146), S171 (≠ A147), Q172 (= Q148), S198 (≠ Q169), Y201 (≠ S172), D314 (= D299), N337 (≠ E322), K341 (= K326)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: R27 (= R4), Q172 (= Q148), Y201 (≠ S172), D314 (= D299), K341 (= K326)
Sites not aligning to the query:
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
28% identity, 97% coverage: 1:405/417 of query aligns to 24:417/426 of Q9KRB0
Sites not aligning to the query:
P11043 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EC 2.5.1.19 from Petunia hybrida (Petunia) (see paper)
27% identity, 99% coverage: 1:412/417 of query aligns to 97:513/516 of P11043
- G173 (= G72) mutation to A: Resistance to glyphosate due to a lower affinity. Slight reduction in EPSP synthase activity.
7tm5B Crystal structure of shikimate-3-phosphate bound 3-phosphoshikimate 1- carboxyvinyltransferase from klebsiella pneumoniae
27% identity, 94% coverage: 14:405/417 of query aligns to 37:416/427 of 7tm5B
Sites not aligning to the query:
7tm6A Crystal structure of shikimate-3-phosphate and glyphosate bound 3- phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae
27% identity, 94% coverage: 14:405/417 of query aligns to 36:415/426 of 7tm6A
- binding glyphosate: G95 (= G72), R123 (= R100), Q170 (= Q148), D312 (= D299), E340 (= E327), R343 (= R330), H384 (= H373), R385 (= R374)
- binding shikimate-3-phosphate: T96 (= T73), S168 (≠ A145), S169 (= S146), Q170 (= Q148), S196 (vs. gap), Y199 (≠ S172), D312 (= D299), N335 (≠ E322), K339 (= K326)
Sites not aligning to the query:
2pq9A E. Coli epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog (see paper)
27% identity, 94% coverage: 14:405/417 of query aligns to 37:416/427 of 2pq9A
- active site: D49 (= D26), N94 (= N70), P119 (≠ S95), R124 (= R100), D313 (= D299), E341 (= E327), H385 (= H373), R386 (= R374), K411 (≠ T400)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: G96 (= G72), T97 (= T73), R124 (= R100), S169 (≠ A145), S170 (= S146), Q171 (= Q148), S197 (≠ Q169), Y200 (≠ S172), D313 (= D299), N336 (≠ E322), K340 (= K326), R344 (= R330), H385 (= H373), R386 (= R374), K411 (≠ T400)
Sites not aligning to the query:
2aa9A Epsp synthase liganded with shikimate (see paper)
27% identity, 94% coverage: 14:405/417 of query aligns to 37:416/427 of 2aa9A
- active site: D49 (= D26), N94 (= N70), P119 (≠ S95), R124 (= R100), D313 (= D299), E341 (= E327), H385 (= H373), R386 (= R374), K411 (≠ T400)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: T97 (= T73), Q171 (= Q148), Y200 (≠ S172), D313 (= D299), K340 (= K326)
Sites not aligning to the query:
1x8tA Epsps liganded with the (r)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
27% identity, 94% coverage: 14:405/417 of query aligns to 37:416/427 of 1x8tA
- active site: D49 (= D26), N94 (= N70), P119 (≠ S95), R124 (= R100), D313 (= D299), E341 (= E327), H385 (= H373), R386 (= R374), K411 (≠ T400)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: T97 (= T73), S169 (≠ A145), S170 (= S146), Q171 (= Q148), S197 (≠ Q169), Y200 (≠ S172), D313 (= D299), N336 (≠ E322), K340 (= K326), R344 (= R330), H385 (= H373), R386 (= R374)
Sites not aligning to the query:
1x8rA Epsps liganded with the (s)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
27% identity, 94% coverage: 14:405/417 of query aligns to 37:416/427 of 1x8rA
- active site: D49 (= D26), N94 (= N70), P119 (≠ S95), R124 (= R100), D313 (= D299), E341 (= E327), H385 (= H373), R386 (= R374), K411 (≠ T400)
- binding [3r-[3a,4a,5b(s*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: G96 (= G72), T97 (= T73), R124 (= R100), S169 (≠ A145), S170 (= S146), Q171 (= Q148), S197 (≠ Q169), Y200 (≠ S172), D313 (= D299), N336 (≠ E322), K340 (= K326), E341 (= E327), H385 (= H373), K411 (≠ T400)
Sites not aligning to the query:
Query Sequence
>WP_083931526.1 NCBI__GCF_000385335.1:WP_083931526.1
MSHRALIFGLLCIGRTHIEGLLEGEDVLHTAAACRALGAKVERLAPGQWTVWGAGLGSLL
APRDTLDFGNAGTGSRLMMGVVGGHGIFARFDGDSSLRKRPMRRILDPLTLMGANVVSEA
PGGCCPIELAGTNEPSPITYQTPVASAQIKSAVLLAGLNSPGSTTVIEQEASRDHTEKML
LHFGAEVQSEAYGKHGRKIILKGRPKLMPAEVIIPADPSSAAFPLVAALIVPESEIIIEA
MMMNPLRTGLLTTLCEMGADIEVLDRRIEGGEEVADLRVRASALRGVDVPAARAPSMIDE
YPILAVAAAFAEGETRMRGLHELRVKESDRLAAVAEGLRQAGVEVAIEGDDLIVQGQAGL
VRGGGLVETHLDHRIAMSFLCLGLAAEAPMAVDDDRMIMTSFPGFRALMENLGARFS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory