Comparing WP_084037344.1 NCBI__GCF_000504245.1:WP_084037344.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
40% identity, 83% coverage: 27:203/213 of query aligns to 85:256/261 of 6wyeA
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
43% identity, 72% coverage: 27:180/213 of query aligns to 83:230/243 of 7ra4A
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
39% identity, 74% coverage: 23:179/213 of query aligns to 102:252/280 of 7bw9A
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
41% identity, 77% coverage: 18:180/213 of query aligns to 74:230/243 of 4n69A
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
39% identity, 77% coverage: 18:182/213 of query aligns to 99:265/270 of 3p47A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
39% identity, 77% coverage: 18:182/213 of query aligns to 97:263/267 of 3q1xA
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
40% identity, 77% coverage: 18:180/213 of query aligns to 70:220/233 of 4n6bA
Sites not aligning to the query:
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
38% identity, 74% coverage: 23:180/213 of query aligns to 80:231/250 of 4hzdA
Sites not aligning to the query:
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
39% identity, 72% coverage: 27:180/213 of query aligns to 80:227/258 of 4h7oA
Sites not aligning to the query:
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
36% identity, 89% coverage: 18:206/213 of query aligns to 71:255/258 of 8i04A
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
37% identity, 77% coverage: 18:180/213 of query aligns to 75:231/262 of 1t3dA
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
38% identity, 77% coverage: 18:180/213 of query aligns to 74:230/246 of 8i09A
Sites not aligning to the query:
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
38% identity, 77% coverage: 18:180/213 of query aligns to 75:231/244 of 8i06A
Sites not aligning to the query:
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
32% identity, 93% coverage: 9:206/213 of query aligns to 64:255/257 of 1ssqD
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
36% identity, 81% coverage: 9:181/213 of query aligns to 71:235/272 of 3gvdI
1sstA Serine acetyltransferase- complex with coa (see paper)
31% identity, 83% coverage: 9:185/213 of query aligns to 64:225/233 of 1sstA
Sites not aligning to the query:
G3XD01 UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase; UDP-D-GlcNAc3NA N-acetyltransferase; UDP-2-acetamido-3-amino-2,3-dideoxy-alpha-D-glucuronic acid 3-N-acetyltransferase; EC 2.3.1.201 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
30% identity, 50% coverage: 77:183/213 of query aligns to 26:142/191 of G3XD01
3mqhA Crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with coa and udp-3-amino-2-acetamido-2,3-dideoxy glucuronic acid (see paper)
30% identity, 48% coverage: 78:180/213 of query aligns to 27:139/191 of 3mqhA
Sites not aligning to the query:
Q97R46 Bifunctional protein GlmU; EC 2.7.7.23; EC 2.3.1.157 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see 2 papers)
30% identity, 47% coverage: 86:185/213 of query aligns to 331:436/459 of Q97R46
Sites not aligning to the query:
3mqgC Crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with acetyl-coa (see paper)
30% identity, 48% coverage: 78:180/213 of query aligns to 28:140/192 of 3mqgC
Sites not aligning to the query:
>WP_084037344.1 NCBI__GCF_000504245.1:WP_084037344.1
MTVTTPPSDQAWQGPGHPGLFALLREDLRTVVERDPSIAGPVEALLHPALPALWVHRFAH
RRYRGGARLSARLAMVLVRAVTGVEIHPGARLGRRVFIDHGSGVVIGETAVVGDDVTIYH
QVTLGALGWWRDNRRDDGERRHPMVGSGVVIGANASVLGPVSIGAGAVIGAHALVTDDMP
AGARANAPAGSVRQGRATTALDLLRHTASAGSW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory