Comparing WP_084057134.1 NCBI__GCF_900176285.1:WP_084057134.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
43% identity, 92% coverage: 13:334/349 of query aligns to 5:329/339 of 6ioxA
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
42% identity, 87% coverage: 30:334/349 of query aligns to 21:319/325 of 1xcoD
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
39% identity, 86% coverage: 30:328/349 of query aligns to 18:316/332 of 2af3C
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
39% identity, 86% coverage: 30:328/349 of query aligns to 19:317/333 of P38503
Sites not aligning to the query:
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
39% identity, 88% coverage: 30:336/349 of query aligns to 406:707/714 of Q8ZND6
Sites not aligning to the query:
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
31% identity, 90% coverage: 22:336/349 of query aligns to 437:751/759 of P76558
Sites not aligning to the query:
6zngF Maeb full-length acetyl-coa bound state (see paper)
31% identity, 93% coverage: 6:328/349 of query aligns to 413:732/753 of 6zngF
Sites not aligning to the query:
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
23% identity, 60% coverage: 96:303/349 of query aligns to 41:249/285 of 3uf6A
Sites not aligning to the query:
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
23% identity, 60% coverage: 96:303/349 of query aligns to 43:251/288 of 3u9eB
Sites not aligning to the query:
>WP_084057134.1 NCBI__GCF_900176285.1:WP_084057134.1
MTSSSGLSSVFRSAIVDEYRQQCMRNPGLVALADSLDPRVWEAASRLQAEGLARPVLVQS
PFALRAKMRAEGFFRTAFAVVDPTSPALFARNVEDFLKIRQAKGKDVTEEQAVKAMRCPL
AAAAMLVRRREVHVGLAGNLSATADVLRAGLAVLERKPGIQAVSSFFLMISPDGERRFIF
SDCAVVPEPTAPVLADIAMTSAEQARRLLKEEPRVALLSFSTKGSANHSRAQLVADATRL
LQQRAPDLLADGELQFDAALVPDVAALKAPGSPLQGRANVLIFPSLEAGNIGYKLVQRLG
GYRALGPFLQGFQGGWHDLSRGCSAEDIYQLALIALCLERGAMVTKHAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory