Comparing WP_084057261.1 NCBI__GCF_900176285.1:WP_084057261.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8z1wD Cryo-em structure of escherichia coli dppbcdf complex bound to atpgammas
43% identity, 98% coverage: 3:322/326 of query aligns to 4:315/326 of 8z1wD
Sites not aligning to the query:
8z1xD Cryo-em structure of escherichia coli dppbcdf complex bound to amppnp
43% identity, 98% coverage: 3:322/326 of query aligns to 3:314/325 of 8z1xD
Sites not aligning to the query:
8j5qD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- translocation state (see paper)
43% identity, 83% coverage: 3:271/326 of query aligns to 348:610/611 of 8j5qD
Sites not aligning to the query:
8j5tD Cryo-em structure of mycobacterium tuberculosis oppabcd in the catalytic intermediate state (see paper)
43% identity, 82% coverage: 3:268/326 of query aligns to 348:607/608 of 8j5tD
Sites not aligning to the query:
8j5sD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- catalytic intermediate state (see paper)
43% identity, 82% coverage: 3:268/326 of query aligns to 348:607/608 of 8j5sD
Sites not aligning to the query:
8z1yC Cryo-em structure of escherichia coli dppabcdf in the pre-catalytic state
35% identity, 99% coverage: 2:323/326 of query aligns to 1:315/324 of 8z1yC
8z1xC Cryo-em structure of escherichia coli dppbcdf complex bound to amppnp
35% identity, 99% coverage: 2:323/326 of query aligns to 1:315/326 of 8z1xC
8xfcD Cryo-em structure of the atp-bound mtb dppabcd with the d445a mutation of dppa
40% identity, 71% coverage: 33:264/326 of query aligns to 283:514/517 of 8xfcD
Sites not aligning to the query:
8wdbD Cryo-em structure of the atp-bound dppabcd complex
40% identity, 71% coverage: 33:264/326 of query aligns to 282:513/513 of 8wdbD
Sites not aligning to the query:
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
33% identity, 99% coverage: 3:325/326 of query aligns to 4:319/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
33% identity, 99% coverage: 3:325/326 of query aligns to 3:308/310 of 4fwiB
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
34% identity, 90% coverage: 32:324/326 of query aligns to 20:323/330 of P0AAH4
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
37% identity, 71% coverage: 33:263/326 of query aligns to 17:247/250 of 7z18I
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
37% identity, 71% coverage: 33:263/326 of query aligns to 17:247/253 of 7z15I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
36% identity, 71% coverage: 33:263/326 of query aligns to 17:247/250 of 7z16I
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 87% coverage: 31:314/326 of query aligns to 17:286/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 87% coverage: 31:314/326 of query aligns to 18:287/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 87% coverage: 31:314/326 of query aligns to 18:287/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 87% coverage: 31:314/326 of query aligns to 18:287/344 of 3tuiC
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp-binding protein
34% identity, 72% coverage: 32:265/326 of query aligns to 19:248/375 of 2d62A
>WP_084057261.1 NCBI__GCF_900176285.1:WP_084057261.1
MAVLQVENLKQHFYLQPGLLERVLSGKKPSVIKAVDDVSFTVEAGEILGLAGESGCGKST
LCLAIANLRRPTAGSIRYQGSDLGRMSVQEQKDYRRKVQLVFQDPFESLNPRFTVYDLVA
EPLRAFKIGSRQEKRDRVRETLTRVGLSPDDYLDRYPHQMSGGERQRVGIAQALVLDPQL
VIADEPLSMLDVSIRAGILDLIRDLSEQMHFSCIYVSHDLSILSNISERLMIMYLGRVME
LGATKDVITKPLHPYAQALISAVPIPDPEYRRPIPEIHGEVSQPIDPPPGCRFQSRCLKV
MEHCRTDTPLLKEVEPGHHVACHLYA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory