Comparing WP_084164601.1 NCBI__GCF_000576635.1:WP_084164601.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
8y4wA Sialic acid bound form of tripartite atp-independent periplasmic (trap) transporter from fusobacterium nucleatum.
34% identity, 51% coverage: 73:190/233 of query aligns to 19:137/612 of 8y4wA
Sites not aligning to the query:
>WP_084164601.1 NCBI__GCF_000576635.1:WP_084164601.1
MSTRSSRTSRGSSISTRASARSAPASNGPAAGPGRPGPALHRRGLSMLPFLKSCDTWFHR
CLAGLCALLVAVMLVTVGAQIVMRYALNAPLVWSEELARFTMVWLALLASALAMRRAQHI
AMTGLYTLPPSVEPILKALTALATILILGVLTYHGWELAERTMRQRSPALGLPMGYMYAA
IPIATFLMMIGHALALITRTEPPLVEPSPDIAGDQPGTLSSAYPSAHYNKEPI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory