Comparing WP_084236418.1 NCBI__GCF_001592305.1:WP_084236418.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00903 Aminodeoxychorismate synthase component 2; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 2; Aminodeoxychorismate synthase, glutamine amidotransferase component; EC 2.6.1.85 from Escherichia coli (strain K12) (see paper)
59% identity, 96% coverage: 7:196/197 of query aligns to 2:187/187 of P00903
Q42565 Anthranilate synthase beta subunit 1, chloroplastic; Anthranilate synthase component 2-1; Anthranilate synthase, glutamine amidotransferase component 2-1; Protein TRYPTOPHAN BIOSYNTHESIS 4; Protein WEAK ETHYLENE INSENSITIVE 7; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
48% identity, 96% coverage: 7:195/197 of query aligns to 75:265/276 of Q42565
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
45% identity, 99% coverage: 3:197/197 of query aligns to 2:191/673 of 8hx8A
Sites not aligning to the query:
P00900 Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 from Serratia marcescens (see 3 papers)
42% identity, 97% coverage: 7:197/197 of query aligns to 4:190/193 of P00900
Sites not aligning to the query:
1i7qB Anthranilate synthase from s. Marcescens (see paper)
42% identity, 97% coverage: 7:197/197 of query aligns to 3:189/192 of 1i7qB
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
35% identity, 99% coverage: 3:197/197 of query aligns to 1:148/632 of 8hx9A
Sites not aligning to the query:
7yc6A Crystal structure of d110p mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase
32% identity, 95% coverage: 7:193/197 of query aligns to 2:174/183 of 7yc6A
2ywcA Crystal structure of gmp synthetase from thermus thermophilus in complex with xmp
29% identity, 97% coverage: 7:197/197 of query aligns to 2:184/475 of 2ywcA
Sites not aligning to the query:
P27708 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Homo sapiens (Human) (see 7 papers)
29% identity, 83% coverage: 16:179/197 of query aligns to 185:338/2225 of P27708
Sites not aligning to the query:
Q9LVW7 Carbamoyl phosphate synthase small chain, chloroplastic; Carbamoyl phosphate synthetase glutamine chain; Protein VENOSA 6; EC 6.3.5.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 90% coverage: 19:195/197 of query aligns to 254:421/430 of Q9LVW7
P08955 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Mesocricetus auratus (Golden hamster) (see paper)
28% identity, 83% coverage: 16:179/197 of query aligns to 185:338/2225 of P08955
Sites not aligning to the query:
1ce8B Carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp (see paper)
27% identity, 90% coverage: 19:195/197 of query aligns to 203:371/379 of 1ce8B
Sites not aligning to the query:
P0A6F1 Carbamoyl phosphate synthase small chain; Carbamoyl phosphate synthetase glutamine chain; EC 6.3.5.5 from Escherichia coli (strain K12) (see paper)
27% identity, 90% coverage: 19:195/197 of query aligns to 204:372/382 of P0A6F1
Sites not aligning to the query:
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
33% identity, 71% coverage: 56:194/197 of query aligns to 72:207/693 of P49915
Sites not aligning to the query:
2vxoB Human gmp synthetase in complex with xmp (see paper)
33% identity, 71% coverage: 56:194/197 of query aligns to 50:182/658 of 2vxoB
Sites not aligning to the query:
1c3oB Crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine (see paper)
26% identity, 90% coverage: 19:195/197 of query aligns to 203:371/379 of 1c3oB
Sites not aligning to the query:
P07259 Multifunctional protein URA2; Pyrimidine-specific carbamoyl phosphate synthase-aspartate carbamoyl transferase; CPSase-ATCase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 90% coverage: 3:180/197 of query aligns to 225:389/2214 of P07259
Sites not aligning to the query:
P05990 Multifunctional protein r; Protein rudimentary; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Drosophila melanogaster (Fruit fly) (see 2 papers)
26% identity, 74% coverage: 35:179/197 of query aligns to 214:355/2224 of P05990
Sites not aligning to the query:
3r75B Crystal structure of 2-amino-2-desoxyisochorismate synthase (adic) synthase phze from burkholderia lata 383 in complex with benzoate, pyruvate, glutamine and contaminating zn2+ (see paper)
27% identity, 97% coverage: 6:197/197 of query aligns to 432:617/622 of 3r75B
Sites not aligning to the query:
Q18990 Multifunctional protein pyr-1; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Caenorhabditis elegans (see 3 papers)
29% identity, 64% coverage: 54:179/197 of query aligns to 219:341/2198 of Q18990
Sites not aligning to the query:
>WP_084236418.1 NCBI__GCF_001592305.1:WP_084236418.1
MTKKIQLLMVDNYDSFTYNIVQYFGELGADVTVVRNDEITVDEIQRRVDAGQIDRLVISP
GPCSPAEAGISVPAIQHFAGKLPILGVCLGHQSIGAAFGGKIIRAQELMHGKTSVITTTQ
EGVFAGLPKQFTVNRYHSLAIERETCPDCLKVTAWTDDGEIMGVKHKTLPIEGVQFHPES
ILTEHGHAMLKNFLEQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory