Comparing WP_084274669.1 NCBI__GCF_900176045.1:WP_084274669.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
1nsjA Crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima (see paper)
43% identity, 99% coverage: 1:194/196 of query aligns to 2:203/205 of 1nsjA
1lbmA Crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5- phosphate (rcdrp) (see paper)
42% identity, 99% coverage: 1:194/196 of query aligns to 2:192/194 of 1lbmA
1piiA Three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution (see paper)
34% identity, 92% coverage: 4:184/196 of query aligns to 258:440/452 of 1piiA
Sites not aligning to the query:
>WP_084274669.1 NCBI__GCF_900176045.1:WP_084274669.1
MRVKICGITNLEDALVAIEAGADALGFVFYPDSPRYIDPAKAAMIVADLPPFVERVGLFV
NASKDFIEEVCKATNMSLAQLHFDVDEEFIESLAIKALPVVRARSKDDIKRFANRYRLVD
AYVPQFGGAGKRVALEWFEGVDCSKIILAGGLTPQNVGEVKKYDFYGVDVSSGVEAKKGK
KDPKKVREFIAKAKFE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory