SitesBLAST
Comparing WP_084274777.1 NCBI__GCF_900176045.1:WP_084274777.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P22106 Asparagine synthetase B [glutamine-hydrolyzing]; AS-B; EC 6.3.5.4 from Escherichia coli (strain K12) (see 2 papers)
35% identity, 59% coverage: 1:337/570 of query aligns to 1:358/554 of P22106
- M1 (= M1) modified: Initiator methionine, Removed
- C2 (= C2) mutation C->A,S: Loss of glutamine-dependent activity but no effect on ammonia-dependent asparagine synthetase activity.
- H30 (= H25) mutation to A: 4,5-fold decrease in glutamine affinity.
- D34 (= D29) mutation D->N,E: Little effect on the kinetic properties.
- H81 (≠ Y73) mutation to A: 5-fold decrease in glutamine affinity.
- A105 (vs. gap) mutation to H: Little effect on the kinetic properties.
- E349 (= E328) mutation E->A,Q: Loss of glutamine- and ammonia-dependent synthetase activity, but still exhibits glutaminase activity.; mutation to D: 5-fold increase in affinity for aspartate when assaying both the glutamine- and ammonia-dependent synthetase reactions, and 2-fold decrease in kcat for these reactions. Modifies the product glutamate/asparagine stoichiometry.
1ct9A Crystal structure of asparagine synthetase b from escherichia coli (see paper)
35% identity, 59% coverage: 3:337/570 of query aligns to 2:341/497 of 1ct9A
- active site: L50 (= L46), N74 (= N67), G75 (= G68), T305 (≠ S304), R308 (vs. gap), E332 (= E328)
- binding adenosine monophosphate: L232 (= L226), L233 (= L227), S234 (= S228), S239 (= S233), A255 (≠ S251), V256 (≠ I252), D263 (≠ E261), M316 (≠ L312), S330 (= S326), G331 (= G327), E332 (= E328)
- binding glutamine: R49 (= R45), L50 (= L46), I52 (= I48), V53 (≠ L49), N74 (= N67), G75 (= G68), E76 (= E69), D98 (≠ E80)
Sites not aligning to the query:
P78753 Probable asparagine synthetase [glutamine-hydrolyzing]; Glutamine-dependent asparagine synthetase; EC 6.3.5.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 77% coverage: 1:437/570 of query aligns to 1:478/557 of P78753
- S391 (≠ K359) modified: Phosphoserine
Sites not aligning to the query:
- 489 modified: Phosphoserine
6gq3A Human asparagine synthetase (asns) in complex with 6-diazo-5-oxo-l- norleucine (don) at 1.85 a resolution (see paper)
29% identity, 59% coverage: 2:337/570 of query aligns to 1:361/509 of 6gq3A
- active site: W4 (≠ F5), L49 (= L46), N74 (= N67), G75 (= G68), T324 (≠ S304), R327 (vs. gap)
- binding 5-oxo-l-norleucine: C1 (= C2), R48 (= R45), V51 (≠ I48), V52 (≠ L49), Y73 (≠ F66), N74 (= N67), G75 (= G68), E76 (= E69), V95 (≠ E80), D96 (≠ A81)
P08243 Asparagine synthetase [glutamine-hydrolyzing]; Cell cycle control protein TS11; Glutamine-dependent asparagine synthetase; EC 6.3.5.4 from Homo sapiens (Human) (see 7 papers)
27% identity, 59% coverage: 1:337/570 of query aligns to 1:374/561 of P08243
- C2 (= C2) active site, For GATase activity; mutation to A: Loss of the glutamine-dependent asparagine synthetase activity, while the ammonia-dependent activity remained unaffected.
- A6 (≠ G6) to E: in ASNSD; dramatic reduction in protein abundance; dbSNP:rs398122975
- V210 (≠ F194) to E: in dbSNP:rs1049674
- F362 (vs. gap) to V: in ASNSD; dramatic reduction in protein abundance; dbSNP:rs398122973
Sites not aligning to the query:
- 550 R → C: in ASNSD; increases level of protein abundance; dbSNP:rs398122974
1jgtB Crystal structure of beta-lactam synthetase (see paper)
27% identity, 35% coverage: 91:290/570 of query aligns to 111:306/500 of 1jgtB
Sites not aligning to the query:
- active site: 73, 74, 319, 345, 379, 440
- binding diphosphomethylphosphonic acid adenosyl ester: 327, 344, 345, 348, 420, 440
- binding n2-(carboxyethyl)-l-arginine: 323, 345, 346, 348, 349, 354, 370, 379
- binding magnesium ion: 348
1mb9A Beta-lactam synthetase complexed with atp (see paper)
28% identity, 35% coverage: 91:290/570 of query aligns to 108:297/485 of 1mb9A
- binding adenosine monophosphate: V235 (≠ L226), L236 (= L227), S242 (= S233), S260 (= S251), M261 (≠ I252)
- binding adenosine-5'-triphosphate: V235 (≠ L226), L236 (= L227), S237 (= S228), G239 (= G230), D241 (= D232), S242 (= S233), S260 (= S251), M261 (≠ I252)
- binding magnesium ion: D241 (= D232)
- binding pyrophosphate 2-: S237 (= S228), G239 (= G230), D241 (= D232), S242 (= S233)
Sites not aligning to the query:
- active site: 70, 71, 310, 336, 370, 431
- binding adenosine monophosphate: 314, 318, 335, 336
- binding adenosine-5'-triphosphate: 318, 335, 339, 411, 431
- binding magnesium ion: 339
- binding pyrophosphate 2-: 339, 411, 431
1mbzA Beta-lactam synthetase with trapped intermediate (see paper)
28% identity, 35% coverage: 91:290/570 of query aligns to 107:298/496 of 1mbzA
Sites not aligning to the query:
- active site: 69, 70, 311, 337, 371, 432
- binding arginine-n-methylcarbonyl phosphoric acid 5'-adenosine ester: 315, 319, 336, 337, 338, 340, 341, 362, 371, 432, 434, 435
- binding magnesium ion: 340
- binding pyrophosphate 2-: 340, 412, 432, 433
1mc1A Beta-lactam synthetase with product (dgpc), amp and ppi (see paper)
28% identity, 35% coverage: 91:290/570 of query aligns to 103:293/491 of 1mc1A
Sites not aligning to the query:
- active site: 65, 66, 306, 332, 366, 427
- binding adenosine monophosphate: 331, 427, 430
- binding magnesium ion: 335
- binding deoxyguanidinoproclavaminic acid: 310, 332, 333, 336, 357, 366, 427
- binding pyrophosphate 2-: 335, 407, 427, 428
Q9XB61 Carbapenam-3-carboxylate synthase; Carbapenam-3-carboxylate ligase; EC 6.3.3.6 from Pectobacterium carotovorum subsp. carotovorum (Erwinia carotovora subsp. carotovora) (see 3 papers)
34% identity, 19% coverage: 227:336/570 of query aligns to 245:353/503 of Q9XB61
- I270 (= I252) binding ATP
- GYGSD 344:348 (≠ GEGGD 327:331) binding ATP
- Y345 (≠ E328) mutation to A: Loss of activity.; mutation to F: Reduces catalytic efficiency.
- G346 (= G329) binding substrate
Sites not aligning to the query:
- 244:251 binding ATP
- 371 binding substrate
- 374 binding substrate
- 380 E→A: Loss of activity.; E→D: Reduces catalytic efficiency.; E→Q: Reduces catalytic efficiency.
- 421 binding ATP
- 443 mutation K->A,M: Loss of activity.
- 444:446 binding ATP
1q19A Carbapenam synthetase (see paper)
34% identity, 19% coverage: 227:336/570 of query aligns to 244:352/500 of 1q19A
- active site: L318 (≠ A305), E321 (≠ P308), Y344 (≠ E328)
- binding diphosphomethylphosphonic acid adenosyl ester: L244 (= L227), S245 (= S228), D249 (= D232), S250 (= S233), S268 (= S251), I269 (= I252), T342 (≠ S326), G343 (= G327), D347 (= D331)
- binding (2s,5s)-5-carboxymethylproline: Y344 (≠ E328), G345 (= G329), L348 (≠ E332)
Sites not aligning to the query:
Query Sequence
>WP_084274777.1 NCBI__GCF_900176045.1:WP_084274777.1
MCAIFGVIGKIDREKALNAFSLLSHRGEDESGVYEREGVFLAHHRLYILNKDAKQPFVQN
SKVLLFNGEIYNYEDFHTSEAAAILEVAPDFSKLDGMFALALLDKEKLYLARDLFGKKPL
YYAFWQDSFIFASEIKAILAYTNEQKINARALSSYLSFGAVVGRETFYEGIYKLDGGEIL
ELDIKRLYYACKRFTTLLQKRSGDLKRLLVAAVKKRLQGDFPAVALLSGGVDSSFVSAIA
KRLQGSLATYSIGYEEGRYSELPYAQEVAQYIGSDHHEIIFTKDDFFATLERASIFFDEP
IGDSASLPLFYLMERIKKDGAKVVLSGEGGDEIFLGYRQYFEFFDLYKARDLKYKNWLKN
YFRSNFSPNKEWEWYKRVFSDEVIFRSSCEVFTDLQKNLFLRQNVKDNESLQVLQPYLEE
WERSGWKDGAAFFTYIDIKVRLQSLYLAKLDTTSMAYTIEARTPLLDSSVLYSAFADPQR
SKAPKYLLKKIASKYIPQSIIERKKRGFSYPALEWLQSSGSDQKLREANKRFHLFKQEQL
EFLIENAKRNRFTRHYWLVYALLDWMERKF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory