SitesBLAST
Comparing WP_084275376.1 NCBI__GCF_900176045.1:WP_084275376.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q04797 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Bacillus subtilis (strain 168) (see paper)
53% identity, 97% coverage: 2:333/342 of query aligns to 3:337/346 of Q04797
- S98 (= S99) modified: Phosphoserine
- Y146 (≠ F149) modified: Phosphotyrosine
2r00C Crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae (see paper)
52% identity, 97% coverage: 2:333/342 of query aligns to 2:328/336 of 2r00C
P23247 Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
52% identity, 97% coverage: 2:333/342 of query aligns to 3:329/337 of P23247
- C132 (= C133) active site, Acyl-thioester intermediate
3q11A Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with NADP and aspartyl beta- difluorophosphonate (see paper)
50% identity, 96% coverage: 4:333/342 of query aligns to 2:337/358 of 3q11A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), A71 (= A75), T75 (≠ V79), G160 (= G166), M161 (≠ K167), G162 (≠ S168)
- binding 5,5-difluoro-4-oxo-5-phosphono-D-norvaline: R98 (= R102), N126 (= N132), C127 (= C133), Q154 (= Q160), G158 (= G164), E219 (= E216), K222 (= K219), R244 (= R240)
4r5hA Crystal structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide-adenine-dinucleotide-phosphate and 3-carboxy-propenyl- phthalic acid (see paper)
50% identity, 96% coverage: 4:333/342 of query aligns to 2:337/359 of 4r5hA
- binding 3-[(1E)-3-carboxyprop-1-en-1-yl]benzene-1,2-dicarboxylic acid: S73 (≠ G77), T94 (= T98), S95 (= S99), R98 (= R102), N126 (= N132), C127 (= C133), Q154 (= Q160), G158 (= G164), K222 (= K219), R244 (= R240), H251 (= H247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), V13 (= V15), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), S70 (= S74), A71 (= A75), G72 (= G76), T75 (≠ V79), N93 (= N97), T94 (= T98), P125 (= P131), N126 (= N132), C127 (= C133), G160 (= G166), M161 (≠ K167), G328 (= G324)
4r4jA Crystal structure of complex sp_asadh with 3-carboxypropyl-phthalic acid and nicotinamide adenine dinucleotide phosphate (see paper)
50% identity, 96% coverage: 4:333/342 of query aligns to 2:337/359 of 4r4jA
- binding 3-(3-carboxypropyl)benzene-1,2-dicarboxylic acid: T94 (= T98), S95 (= S99), R98 (= R102), N126 (= N132), C127 (= C133), Q154 (= Q160), G158 (= G164), E219 (= E216), K222 (= K219), R244 (= R240), H251 (= H247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), V13 (= V15), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), S70 (= S74), A71 (= A75), G72 (= G76), T75 (≠ V79), N93 (= N97), T94 (= T98), N126 (= N132), C127 (= C133), G160 (= G166), M161 (≠ K167), G328 (= G324)
3pyxB Crystals structure of aspartate beta-semialdehyde dehydrogenase complex with NADP and 2-aminoterephthalate (see paper)
50% identity, 96% coverage: 4:333/342 of query aligns to 2:337/359 of 3pyxB
- binding 2-aminobenzene-1,4-dicarboxylic acid: R98 (= R102), G158 (= G164), E219 (= E216), K222 (= K219), R244 (= R240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), V13 (= V15), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), S70 (= S74), A71 (= A75), G72 (= G76), T75 (≠ V79), C127 (= C133), S157 (= S163), G158 (= G164), G160 (= G166), M161 (≠ K167), N324 (= N320), L325 (= L321)
4r54A Complex crystal structure of sp-aspartate-semialdehyde-dehydrogenase with 3-carboxy-ethyl-phthalic acid (see paper)
50% identity, 96% coverage: 4:333/342 of query aligns to 2:337/357 of 4r54A
- binding 3-(2-carboxyethyl)benzene-1,2-dicarboxylic acid: G72 (= G76), S73 (≠ G77), T94 (= T98), S95 (= S99), R98 (= R102), K222 (= K219)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), V13 (= V15), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), S70 (= S74), A71 (= A75), G72 (= G76), T75 (≠ V79), N93 (= N97), T94 (= T98), N126 (= N132), C127 (= C133), G160 (= G166), G328 (= G324)
4r41A Complex crystal structure of 4-nitro-2-phosphono-benzoic acid with sp- aspartate-semialdehyde dehydrogenase and nicotinamide-dinucleotide (see paper)
50% identity, 96% coverage: 4:333/342 of query aligns to 2:337/357 of 4r41A
- binding 4-nitro-2-phosphonobenzoic acid: S70 (= S74), G72 (= G76), S73 (≠ G77), N93 (= N97), T94 (= T98), S95 (= S99), R98 (= R102), K222 (= K219)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), A71 (= A75), G160 (= G166), M161 (≠ K167), G162 (≠ S168)
4r3nA Crystal structure of the ternary complex of sp-asadh with NADP and 1, 2,3-benzenetricarboxylic acid (see paper)
50% identity, 96% coverage: 4:333/342 of query aligns to 2:337/357 of 4r3nA
- active site: C127 (= C133), Q154 (= Q160), R244 (= R240), H251 (= H247)
- binding benzene-1,2,3-tricarboxylic acid: S73 (≠ G77), T94 (= T98), S95 (= S99), R98 (= R102), N126 (= N132), K222 (= K219)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), V13 (= V15), A35 (= A37), S36 (= S38), S39 (= S41), T56 (≠ L58), S70 (= S74), A71 (= A75), G72 (= G76), N93 (= N97), T94 (= T98), N126 (= N132), C127 (= C133), G160 (= G166), M161 (≠ K167), G328 (= G324)
3q1lA Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with cysteamine bound covalently to cys 128 (see paper)
50% identity, 96% coverage: 4:333/342 of query aligns to 2:337/357 of 3q1lA
3pwsA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
50% identity, 96% coverage: 4:333/342 of query aligns to 2:337/357 of 3pwsA
- binding (2R)-2-aminohexanedioic acid: R98 (= R102), N126 (= N132), G158 (= G164), I208 (= I205), E219 (= E216), K222 (= K219), R244 (= R240)
- binding adenosine-2'-5'-diphosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), A71 (= A75), T75 (≠ V79), G160 (= G166), M161 (≠ K167)
3pwkA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
50% identity, 96% coverage: 4:333/342 of query aligns to 2:337/357 of 3pwkA
- binding 5'-o-monophosphoryladenylyl(2'->5')adenylyl(2'->5')adenosine: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), A71 (= A75), T75 (≠ V79), G160 (= G166)
- binding trans-cyclohexane-1,4-dicarboxylic acid: R98 (= R102), N126 (= N132), G158 (= G164), A159 (= A165), E219 (= E216), K222 (= K219), R244 (= R240)
2gz3A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP and aspartate- semialdehyde (see paper)
50% identity, 96% coverage: 4:333/342 of query aligns to 2:337/357 of 2gz3A
- active site: C127 (= C133), Q154 (= Q160), R244 (= R240), H251 (= H247)
- binding (2r)-2-amino-4-oxobutanoic acid: C127 (= C133), Q154 (= Q160), G158 (= G164), E219 (= E216), R244 (= R240), H251 (= H247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), V13 (= V15), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), S70 (= S74), A71 (= A75), G72 (= G76), T75 (≠ V79), N93 (= N97), G158 (= G164), G160 (= G166), M161 (≠ K167), N324 (= N320), A329 (= A325)
2gz2A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with 2',5'-adp (see paper)
50% identity, 96% coverage: 4:333/342 of query aligns to 2:337/357 of 2gz2A
- active site: C127 (= C133), Q154 (= Q160), R244 (= R240), H251 (= H247)
- binding adenosine-2'-5'-diphosphate: G8 (= G10), T10 (= T12), G11 (= G13), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), A71 (= A75), T75 (≠ V79)
2gz1A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP (see paper)
50% identity, 96% coverage: 4:333/342 of query aligns to 2:337/357 of 2gz1A
- active site: C127 (= C133), Q154 (= Q160), R244 (= R240), H251 (= H247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), V13 (= V15), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), S70 (= S74), A71 (= A75), G72 (= G76), T75 (≠ V79), N93 (= N97), S157 (= S163), G158 (= G164), G160 (= G166), M161 (≠ K167), N324 (= N320), L325 (= L321)
3pylC Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with d-2,3-diaminopropionate (see paper)
50% identity, 96% coverage: 4:333/342 of query aligns to 2:337/361 of 3pylC
4r51A Crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid (see paper)
50% identity, 96% coverage: 4:333/342 of query aligns to 2:337/360 of 4r51A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), V13 (= V15), A35 (= A37), S36 (= S38), S39 (= S41), T56 (≠ L58), S70 (= S74), A71 (= A75), G72 (= G76), N93 (= N97), T94 (= T98), N126 (= N132), C127 (= C133), G160 (= G166), M161 (≠ K167), G328 (= G324)
- binding phthalic acid: S73 (≠ G77), T94 (= T98), S95 (= S99), R98 (= R102), N126 (= N132), K222 (= K219)
3tz6A Crystal structure of aspartate semialdehyde dehydrogenase complexed with inhibitor smcs (cys) and phosphate from mycobacterium tuberculosis h37rv (see paper)
37% identity, 96% coverage: 4:333/342 of query aligns to 2:337/342 of 3tz6A
- active site: C129 (= C133), Q156 (= Q160), R248 (= R240), H255 (= H247)
- binding cysteine: C129 (= C133), Q156 (= Q160), G160 (= G164), E223 (= E216), R248 (= R240), H255 (= H247)
- binding glycerol: S108 (≠ P112), G187 (≠ S188), F192 (= F193), P201 (≠ Q196), Q225 (≠ M218), R228 (≠ V221), F229 (≠ N222), Q335 (≠ R331)
- binding sulfate ion: R98 (= R102), H117 (≠ A121), R119 (≠ K123), N128 (= N132), C129 (= C133), K226 (= K219), E270 (= E262), R273 (≠ K265)
Sites not aligning to the query:
Q57658 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
31% identity, 89% coverage: 3:305/342 of query aligns to 8:320/354 of Q57658
Sites not aligning to the query:
Query Sequence
>WP_084275376.1 NCBI__GCF_900176045.1:WP_084275376.1
MRKFNVAVVGVTGAVGEEMLRVMEEVDFPVAKLVPLASKRSAGSSVEYKGKEYTVQELTE
DIFEKEDIEIALFSAGGSVSAHYAPYAAEAGAVVIDNTSHFRMDPEVPLVVPEVNPEDIA
AWKTKGIIANPNCSTIQMVQALKPLDEKFGITRVDVATYQATSGAGKSAMDEMVNQMKDF
FNFKLDESEKKKFPHQIALNVIPQIDKFLDNGYTKEEMKMVNETKKIMHKNIEVSATCVR
VPVLRGHSEAVTVWCEKDITPEAAKEALYNGKNIVVMDEPQKSIYPMPITVVDKNETYVG
RIRKDVYRDNVLHMWVVADNLRVGAATNAVRIALKWIEMESA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory