Comparing WP_084471813.1 NCBI__GCF_000527155.1:WP_084471813.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
33% identity, 92% coverage: 8:208/219 of query aligns to 5:222/223 of P9WIC7
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
34% identity, 88% coverage: 8:199/219 of query aligns to 4:212/217 of 4pzaB
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
34% identity, 88% coverage: 8:199/219 of query aligns to 3:207/209 of 4qihA
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
29% identity, 93% coverage: 6:209/219 of query aligns to 1:201/207 of 4ij6A
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
33% identity, 68% coverage: 6:154/219 of query aligns to 1:148/196 of 6m1xC
5zr2C Crystal structure of phosphoserine phosphatase mutant (h9a) from entamoeba histolytica in complex with phosphoserine (see paper)
34% identity, 68% coverage: 6:154/219 of query aligns to 1:148/198 of 5zr2C
P62707 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Escherichia coli (strain K12) (see 6 papers)
33% identity, 54% coverage: 5:123/219 of query aligns to 2:126/250 of P62707
Sites not aligning to the query:
1e59A E.Coli cofactor-dependent phosphoglycerate mutase complexed with vanadate (see paper)
33% identity, 54% coverage: 6:123/219 of query aligns to 1:124/239 of 1e59A
Sites not aligning to the query:
P36623 Phosphoglycerate mutase; PGAM; BPG-dependent PGAM; MPGM; Phosphoglyceromutase; EC 5.4.2.11 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 69% coverage: 9:160/219 of query aligns to 10:171/211 of P36623
Q9HIJ2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) (see paper)
29% identity, 76% coverage: 10:175/219 of query aligns to 5:165/200 of Q9HIJ2
Q9NQ88 Fructose-2,6-bisphosphatase TIGAR; TP53-induced glycolysis and apoptosis regulator; TP53-induced glycolysis regulatory phosphatase; EC 3.1.3.46 from Homo sapiens (Human) (see 4 papers)
40% identity, 42% coverage: 9:101/219 of query aligns to 6:103/270 of Q9NQ88
Sites not aligning to the query:
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
32% identity, 73% coverage: 7:165/219 of query aligns to 2:163/207 of 1h2fA
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
32% identity, 73% coverage: 7:165/219 of query aligns to 2:163/207 of 1h2eA
P9WIC9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 53% coverage: 9:124/219 of query aligns to 7:128/249 of P9WIC9
P00950 Phosphoglycerate mutase 1; PGAM 1; BPG-dependent PGAM 1; MPGM 1; Phosphoglyceromutase 1; EC 5.4.2.11 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 7 papers)
33% identity, 47% coverage: 6:108/219 of query aligns to 1:108/247 of P00950
Sites not aligning to the query:
1qhfA Yeast phosphoglycerate mutase-3pg complex structure to 1.7 a (see paper)
34% identity, 46% coverage: 8:108/219 of query aligns to 2:107/240 of 1qhfA
Sites not aligning to the query:
5pgmE Saccharomyces cerevisiae phosphoglycerate mutase (see paper)
34% identity, 46% coverage: 8:108/219 of query aligns to 2:107/234 of 5pgmE
Sites not aligning to the query:
1bq4A Saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate (see paper)
34% identity, 46% coverage: 8:108/219 of query aligns to 2:107/234 of 1bq4A
Sites not aligning to the query:
1bq3A Saccharomyces cerevisiae phosphoglycerate mutase in complex with inositol hexakisphosphate (see paper)
34% identity, 46% coverage: 8:108/219 of query aligns to 2:107/234 of 1bq3A
Sites not aligning to the query:
1tipA The bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase (see paper)
29% identity, 76% coverage: 9:174/219 of query aligns to 4:165/191 of 1tipA
>WP_084471813.1 NCBI__GCF_000527155.1:WP_084471813.1
MGGGSVTQLIVVRHGRTEWNDTGRIQGASDIALDDVGVEQAARAADALASYQPDRIISSD
LVRASDTAKRVAEVTGVEVELDERLRERSYGPWEGLRMSEISQRYPEDHERWRSGKPLKH
PDIETWEALRKRSGGLVDELKSGDGVTLIFTHGGTARQIVGAALDWSQEDTGTLAGLDNV
HWADIREMKSGRWRLFGYNLGIKDTSQLGMSRIVREQQK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory