Comparing WP_084629538.1 NCBI__GCF_000877395.1:WP_084629538.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ywhA Crystal structure of an abc transporter solute binding protein (ipr025997) from actinobacillus succinogenes 130z (asuc_0499, target efi-511068) with bound d-xylose
40% identity, 89% coverage: 28:333/343 of query aligns to 6:310/310 of 4ywhA
3ma0A Closed liganded crystal structure of xylose binding protein from escherichia coli (see paper)
41% identity, 89% coverage: 28:331/343 of query aligns to 5:307/313 of 3ma0A
4ys6A Crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentans (cphy_1585, target efi- 511156) with bound beta-d-glucose
31% identity, 89% coverage: 27:331/343 of query aligns to 2:323/324 of 4ys6A
3uugA Crystal structure of the periplasmic sugar binding protein chve (see paper)
30% identity, 89% coverage: 28:331/343 of query aligns to 5:328/329 of 3uugA
3urmA Crystal structure of the periplasmic sugar binding protein chve (see paper)
30% identity, 89% coverage: 28:331/343 of query aligns to 5:328/329 of 3urmA
4wwhA Crystal structure of an abc transporter solute binding protein (ipr025997) from mycobacterium smegmatis (msmeg_1704, target efi- 510967) with bound d-galactose
32% identity, 87% coverage: 28:325/343 of query aligns to 5:322/329 of 4wwhA
4rxuA Crystal structure of carbohydrate transporter solute binding protein caur_1924 from chloroflexus aurantiacus, target efi-511158, in complex with d-glucose
32% identity, 87% coverage: 28:325/343 of query aligns to 6:330/340 of 4rxuA
P23905 D-galactose/methyl-galactoside binding periplasmic protein MglB; D-galactose-binding periplasmic protein; GBP; D-galactose/D-glucose-binding protein; GGBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
29% identity, 92% coverage: 2:318/343 of query aligns to 3:327/332 of P23905
P0AEE5 D-galactose/methyl-galactoside binding periplasmic protein MglB; D-galactose-binding periplasmic protein; GBP; D-galactose/D-glucose-binding protein; GGBP from Escherichia coli (strain K12) (see 4 papers)
30% identity, 83% coverage: 2:287/343 of query aligns to 3:303/332 of P0AEE5
Sites not aligning to the query:
1gcaA The 1.7 angstroms refined x-ray structure of the periplasmic glucose(slash)galactose receptor from salmonella typhimurium (see paper)
29% identity, 80% coverage: 45:318/343 of query aligns to 18:304/309 of 1gcaA
Sites not aligning to the query:
3ga5A X-ray structure of glucose/galactose receptor from salmonella typhimurium in complex with (2r)-glyceryl-beta-d-galactopyranoside (see paper)
29% identity, 80% coverage: 45:318/343 of query aligns to 16:302/305 of 3ga5A
Sites not aligning to the query:
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
28% identity, 82% coverage: 22:301/343 of query aligns to 3:281/287 of 4yo7A
2qw1A Glucose/galactose binding protein bound to 3-o-methyl d-glucose (see paper)
29% identity, 69% coverage: 45:282/343 of query aligns to 17:274/305 of 2qw1A
2gbpA Sugar and signal-transducer binding sites of the escherichia coli galactose chemoreceptor protein (see paper)
29% identity, 71% coverage: 45:287/343 of query aligns to 18:280/309 of 2gbpA
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
31% identity, 73% coverage: 28:276/343 of query aligns to 3:248/274 of 2ioyA
6s3tA P46, an immunodominant surface protein from mycoplasma hyopneumoniae (see paper)
25% identity, 81% coverage: 39:317/343 of query aligns to 26:371/374 of 6s3tA
Sites not aligning to the query:
6ruxA P46, an immunodominant surface protein from mycoplasma hyopneumoniae (see paper)
25% identity, 81% coverage: 39:317/343 of query aligns to 24:369/373 of 6ruxA
5kwsA Crystal structure of galactose binding protein from yersinia pestis in the complex with beta d glucose
28% identity, 69% coverage: 45:282/343 of query aligns to 18:275/307 of 5kwsA
Sites not aligning to the query:
8fxtA Escherichia coli periplasmic glucose-binding protein glucose complex: acrylodan conjugate attached at w183c (see paper)
28% identity, 72% coverage: 40:287/343 of query aligns to 9:279/305 of 8fxtA
Sites not aligning to the query:
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
33% identity, 57% coverage: 62:255/343 of query aligns to 41:235/291 of 4rxmA
Sites not aligning to the query:
>WP_084629538.1 NCBI__GCF_000877395.1:WP_084629538.1
MKKFLTAAVAASMTYGGAAFADAHAPVVGVSWSNFQEERWKTDEAAIREALEAAGATYIS
ADAQSSSSKQLSDVESLIAQGADALIILAQDAQAIGPAVEAAANEGIPVVGYDRLIEDPR
AFYLTFDNVEVGRMQARAVLEAQPEGNYVMIKGSPTDPNADFLRGGQQEVLQEAIDSGAI
TIVGEAYTDGWLPANAQRNMEQILTAEDNNVDAVVASNDGTAGGAVAALTAQGMEGIPVS
GQDGDHAALNRIAKGTQTVSVWKDARDLGRAAAEIAVALAGGTEMGDVEGAQSWTSPAGT
EMTAIFLEPVPITADNLSTVVDAGWIDQEALCQGVENGPAPCN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory