Comparing WP_084657418.1 NCBI__GCF_000526715.1:WP_084657418.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WQB3 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
47% identity, 95% coverage: 1:512/539 of query aligns to 41:575/644 of P9WQB3
Sites not aligning to the query:
3hpzB Crystal structure of mycobacterium tuberculosis leua complexed with bromopyruvate
45% identity, 100% coverage: 1:538/539 of query aligns to 24:572/576 of 3hpzB
3figB Crystal structure of leucine-bound leua from mycobacterium tuberculosis (see paper)
45% identity, 100% coverage: 1:538/539 of query aligns to 24:572/577 of 3figB
3hq1A Crystal structure of mycobacterium tuberculosis leua complexed with citrate and mn2+
44% identity, 100% coverage: 1:538/539 of query aligns to 24:569/573 of 3hq1A
1sr9A Crystal structure of leua from mycobacterium tuberculosis (see paper)
44% identity, 100% coverage: 1:538/539 of query aligns to 24:569/573 of 1sr9A
3hpsA Crystal structure of mycobacterium tuberculosis leua complexed with ketoisocaproate (kic)
44% identity, 100% coverage: 1:538/539 of query aligns to 24:571/575 of 3hpsA
4ov9A Structure of isopropylmalate synthase binding with alpha- isopropylmalate (see paper)
28% identity, 68% coverage: 33:397/539 of query aligns to 9:349/380 of 4ov9A
4ov4A Isopropylmalate synthase binding with ketoisovalerate (see paper)
28% identity, 68% coverage: 33:397/539 of query aligns to 9:347/379 of 4ov4A
Q9FN52 Methylthioalkylmalate synthase 3, chloroplastic; 2-isopropylmalate synthase 2; Methylthioalkylmalate synthase-like; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 64% coverage: 14:357/539 of query aligns to 75:414/503 of Q9FN52
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 60% coverage: 35:357/539 of query aligns to 92:414/506 of Q9FG67
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
26% identity, 59% coverage: 25:341/539 of query aligns to 4:308/517 of Q9JZG1
Sites not aligning to the query:
6e1jA Crystal structure of methylthioalkylmalate synthase (bjumam1.1) from brassica juncea (see paper)
25% identity, 64% coverage: 14:357/539 of query aligns to 8:347/409 of 6e1jA
Sites not aligning to the query:
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
28% identity, 48% coverage: 29:285/539 of query aligns to 5:245/308 of 3rmjB
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
23% identity, 62% coverage: 35:368/539 of query aligns to 29:335/399 of 6ktqA
3ivtB Homocitrate synthase lys4 bound to 2-og (see paper)
23% identity, 61% coverage: 9:339/539 of query aligns to 9:320/400 of 3ivtB
Q9Y823 Homocitrate synthase, mitochondrial; HCS; EC 2.3.3.14 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
23% identity, 57% coverage: 35:339/539 of query aligns to 42:325/418 of Q9Y823
Sites not aligning to the query:
3ivsA Homocitrate synthase lys4 (see paper)
27% identity, 25% coverage: 205:339/539 of query aligns to 156:289/364 of 3ivsA
Sites not aligning to the query:
3mi3A Homocitrate synthase lys4 bound to lysine (see paper)
27% identity, 25% coverage: 205:339/539 of query aligns to 158:291/370 of 3mi3A
Sites not aligning to the query:
3a9iA Crystal structure of homocitrate synthase from thermus thermophilus complexed with lys (see paper)
30% identity, 19% coverage: 238:339/539 of query aligns to 185:289/347 of 3a9iA
Sites not aligning to the query:
O87198 Homocitrate synthase; HCS; EC 2.3.3.14 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
30% identity, 19% coverage: 238:339/539 of query aligns to 192:296/376 of O87198
Sites not aligning to the query:
>WP_084657418.1 NCBI__GCF_000526715.1:WP_084657418.1
MNFHKYRPTATPDLPNRQWPNKRLTQAPIWVSVDLRDGNQALAKPMTVEQKLKLWDKLVS
IGFKTIEIGFPSASQLEFDFTRRLIEENRIPDDVTVQVLVQAREHLIKRTYEALEGVKQA
VIHVYNTTSRVQRDKVFEKTQDEIKQMAVQGATWVQDYAKQHPTSNWIFQYSPESFSQTE
TDYAVEVCQAVMDVWQPTPQNKCILNLPATVESTSPNRFADQIEYFITHLQNRESTIISV
HTHNDRGCAVAAAELAILAGADRVEGTLLGNGERTGNMDIVTLAMNFYSEGINPELNFSN
PDDWIEVVEEVTQIPTHIRHPWVGQAVYTAYSGSHQDAIRKCLTVQKDSNPWDVAYLPID
PKDIQRDYEAIIRVNSQSGKAGAAFVLEQEYGLHLPKWVQQDFAPTAQNCAESTDGVVSH
KILYDAFIKHYKLSESAIQLDHYKLDKQDGKEHLSLNVNGESWQGVGNGTLSALCNAWQN
KTNQEIDVLDYAEHAMQQGKEAKAIAYIYVQVGDQKRIGIAMMEDSLSAMMQALISAVQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory