SitesBLAST
Comparing WP_084687487.1 NCBI__GCF_000967895.1:WP_084687487.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
56% identity, 58% coverage: 311:743/748 of query aligns to 3:431/440 of 3slhD
- active site: K23 (= K331), S24 (= S332), D50 (= D358), N95 (= N402), R125 (= R432), D317 (= D625), E345 (= E653), H388 (= H700), R389 (= R701), T415 (= T727)
- binding glyphosate: K23 (= K331), G97 (= G404), T98 (= T405), R125 (= R432), Q171 (= Q479), D317 (= D625), E345 (= E653), R348 (= R656), H388 (= H700), R389 (= R701)
- binding shikimate-3-phosphate: S24 (= S332), R28 (= R336), S169 (= S477), Q171 (= Q479), R196 (= R504), D317 (= D625), K344 (= K652)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S332), R28 (= R336), T98 (= T405), Q171 (= Q479), R196 (= R504), D317 (= D625), K344 (= K652)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
56% identity, 58% coverage: 311:743/748 of query aligns to 1:429/438 of Q83E11
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
56% identity, 58% coverage: 311:743/748 of query aligns to 3:427/434 of 4egrA
- active site: K23 (= K331), S24 (= S332), D50 (= D358), N95 (= N402), R125 (= R432), D313 (= D625), E341 (= E653), H384 (= H700), R385 (= R701), T411 (= T727)
- binding phosphoenolpyruvate: K23 (= K331), G97 (= G404), T98 (= T405), R125 (= R432), D313 (= D625), E341 (= E653), R344 (= R656), R385 (= R701)
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
49% identity, 55% coverage: 321:734/748 of query aligns to 10:419/427 of Q9S400
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
49% identity, 55% coverage: 321:734/748 of query aligns to 10:419/427 of 1rf6A
- active site: K20 (= K331), S21 (= S332), D47 (= D358), N90 (= N402), D115 (≠ V427), R120 (= R432), D312 (= D625), E340 (= E653), H384 (= H700), R385 (= R701), T412 (= T727)
- binding glyphosate: K20 (= K331), G92 (= G404), T93 (= T405), R120 (= R432), Q168 (= Q479), D312 (= D625), E340 (= E653), R343 (= R656), H384 (= H700), R385 (= R701)
- binding shikimate-3-phosphate: S21 (= S332), R25 (= R336), S166 (= S477), Q168 (= Q479), R193 (= R504), I311 (= I624), D312 (= D625), K339 (= K652)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
49% identity, 55% coverage: 321:734/748 of query aligns to 10:419/427 of 1rf4A
- active site: K20 (= K331), S21 (= S332), D47 (= D358), N90 (= N402), D115 (≠ V427), R120 (= R432), D312 (= D625), E340 (= E653), H384 (= H700), R385 (= R701), T412 (= T727)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K331), S21 (= S332), R25 (= R336), G92 (= G404), T93 (= T405), R120 (= R432), S166 (= S477), A167 (= A478), Q168 (= Q479), R193 (= R504), D312 (= D625), K339 (= K652), E340 (= E653), R343 (= R656), H384 (= H700), R385 (= R701)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
48% identity, 58% coverage: 315:747/748 of query aligns to 12:451/455 of Q9R4E4
- KS 28:29 (= KS 331:332) binding
- R33 (= R336) binding
- NAAT 98:101 (≠ NSGT 402:405) Phosphoenolpyruvate
- A100 (≠ G404) mutation to G: Confers resistance to glyphosate.
- R128 (= R432) binding
- K353 (= K652) binding
- R357 (= R656) binding
- R405 (= R701) binding
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
48% identity, 57% coverage: 315:743/748 of query aligns to 7:442/445 of 2pqcA
- active site: K23 (= K331), S24 (= S332), D50 (= D358), N93 (= N402), R123 (= R432), D321 (= D625), E349 (= E653), H399 (= H700), R400 (= R701), T426 (= T727)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K331), S24 (= S332), R28 (= R336), T96 (= T405), R123 (= R432), S168 (= S477), Q170 (= Q479), D321 (= D625), K348 (= K652), E349 (= E653), R352 (= R656), R400 (= R701)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
48% identity, 57% coverage: 315:743/748 of query aligns to 7:442/445 of 2pqbA
- active site: K23 (= K331), S24 (= S332), D50 (= D358), N93 (= N402), R123 (= R432), D321 (= D625), E349 (= E653), H399 (= H700), R400 (= R701), T426 (= T727)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K331), S24 (= S332), R28 (= R336), A95 (≠ G404), T96 (= T405), R123 (= R432), S168 (= S477), Q170 (= Q479), D321 (= D625), K348 (= K652), E349 (= E653), R352 (= R656), R400 (= R701)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
48% identity, 57% coverage: 315:743/748 of query aligns to 7:442/445 of 2ggaA
- active site: K23 (= K331), S24 (= S332), D50 (= D358), N93 (= N402), R123 (= R432), D321 (= D625), E349 (= E653), H399 (= H700), R400 (= R701), T426 (= T727)
- binding glyphosate: K23 (= K331), A94 (≠ S403), A95 (≠ G404), T96 (= T405), R123 (= R432), D321 (= D625), E349 (= E653), R352 (= R656), R400 (= R701)
- binding shikimate-3-phosphate: S24 (= S332), R28 (= R336), S168 (= S477), A169 (= A478), Q170 (= Q479), R195 (= R504), D321 (= D625), K348 (= K652)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
48% identity, 57% coverage: 315:743/748 of query aligns to 7:442/445 of 2gg6A
- active site: K23 (= K331), S24 (= S332), D50 (= D358), N93 (= N402), R123 (= R432), D321 (= D625), E349 (= E653), H399 (= H700), R400 (= R701), T426 (= T727)
- binding shikimate-3-phosphate: S24 (= S332), R28 (= R336), T96 (= T405), S168 (= S477), Q170 (= Q479), D321 (= D625), K348 (= K652)
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
40% identity, 38% coverage: 8:290/748 of query aligns to 1:282/285 of 3ggoA
- binding 3-(4-hydroxy-phenyl)pyruvic acid: G217 (≠ A225), G218 (= G226), G219 (= G227)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V13 (≠ L20), G14 (= G21), F15 (≠ L22), M16 (≠ I23), D37 (= D44), I38 (≠ R45), S42 (= S49), S73 (= S79), S74 (≠ V80), P75 (= P81), T78 (≠ A84), Q99 (≠ V105), S101 (= S107), A125 (= A134), G131 (= G140), M233 (= M241)
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
40% identity, 38% coverage: 5:290/748 of query aligns to 6:290/293 of 3gggD
- binding nicotinamide-adenine-dinucleotide: V21 (≠ L20), G22 (= G21), F23 (≠ L22), M24 (≠ I23), D45 (= D44), I46 (≠ R45), S50 (= S49), S81 (= S79), S82 (≠ V80), P83 (= P81), V84 (≠ I82), T86 (≠ A84), Q107 (≠ V105), S109 (= S107), G134 (= G135), T135 (≠ S136)
- binding tyrosine: G225 (≠ A225), G226 (= G226)
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
40% identity, 38% coverage: 8:290/748 of query aligns to 1:282/286 of 3ggpA
- binding hydroxyphenyl propionic acid: G218 (= G226), G219 (= G227)
- binding nicotinamide-adenine-dinucleotide: V13 (≠ L20), G14 (= G21), F15 (≠ L22), M16 (≠ I23), D37 (= D44), I38 (≠ R45), S42 (= S49), S73 (= S79), S74 (≠ V80), P75 (= P81), T78 (≠ A84), Q99 (≠ V105), S101 (= S107), G131 (= G140), M233 (= M241)
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
39% identity, 37% coverage: 15:290/748 of query aligns to 7:283/293 of 4wjiA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G19), G13 (= G21), L14 (= L22), I15 (= I23), T36 (≠ D44), R37 (= R45), S38 (≠ N46), T41 (≠ S49), S71 (= S79), V72 (= V80), P73 (= P81), A76 (= A84), V97 (= V105), S99 (= S107), A125 (= A134), S130 (= S139), M234 (= M241)
- binding tyrosine: S99 (= S107), H122 (= H131), A125 (= A134), T127 (≠ S136), R226 (= R233)
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
34% identity, 37% coverage: 14:291/748 of query aligns to 3:280/365 of 6u60B
- binding nicotinamide-adenine-dinucleotide: G10 (= G21), L11 (= L22), I12 (= I23), D32 (= D44), I33 (≠ R45), A67 (≠ S79), P69 (= P81), E72 (≠ A84), V94 (= V105), S96 (= S107), G128 (= G140)
- binding tyrosine: K126 (≠ R138)
Sites not aligning to the query:
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
34% identity, 37% coverage: 14:291/748 of query aligns to 11:288/373 of 5uyyA
Sites not aligning to the query:
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
28% identity, 56% coverage: 316:734/748 of query aligns to 7:419/426 of 3nvsA
- active site: K22 (= K331), S23 (= S332), D49 (= D358), N94 (= N402), P119 (≠ V427), R124 (= R432), H128 (≠ R436), Q135 (≠ E443), Y142 (≠ S450), E144 (≠ D452), A247 (= A547), A255 (≠ S555), D314 (= D625), E342 (= E653), H386 (= H700), R387 (= R701), K412 (≠ T727)
- binding glyphosate: K22 (= K331), G96 (= G404), R124 (= R432), Q172 (= Q479), D314 (= D625), E342 (= E653), R345 (= R656), H386 (= H700), R387 (= R701)
- binding magnesium ion: E123 (≠ K431), Q145 (≠ K453)
- binding shikimate-3-phosphate: K22 (= K331), S23 (= S332), R27 (= R336), T97 (= T405), S170 (= S477), S171 (≠ A478), Q172 (= Q479), S198 (≠ P500), Y201 (≠ T503), D314 (= D625), N337 (≠ E648), K341 (= K652)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S332), R27 (= R336), Q172 (= Q479), Y201 (≠ T503), D314 (= D625), K341 (= K652)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
28% identity, 56% coverage: 316:734/748 of query aligns to 7:419/426 of Q9KRB0
7tm5B Crystal structure of shikimate-3-phosphate bound 3-phosphoshikimate 1- carboxyvinyltransferase from klebsiella pneumoniae
29% identity, 56% coverage: 316:734/748 of query aligns to 7:418/427 of 7tm5B
- binding shikimate-3-phosphate: K22 (= K331), S23 (= S332), R27 (= R336), S169 (≠ A476), S170 (= S477), Q171 (≠ A478), S197 (≠ P500), Y200 (≠ T503), D313 (= D625), N336 (≠ E648), K340 (= K652)
Query Sequence
>WP_084687487.1 NCBI__GCF_000967895.1:WP_084687487.1
MSHSRSVQTLYIPRVAIIGLGLIGCSWVKALKKSKSVGLVSGFDRNIDSMQQALQAGLID
DYSLQINDVVNDADLIIISVPILAVAEVLGQIKSSISEKTILTDVGSVKGNISKDVSKVL
GENFDRFVLGHPIAGSERSGVSAADENLFKRHKIILTPEQRTCERALDLVTDAWKITGGM
VELMSVQRHDEVLAATSHLPHLLAYSLVDTLANDHENNDIFNYAAGGFRDFTRIASSSPI
MWRDIFVGNKDEVLKALDLFTADLQQLRDVVANEDKTQMMGTFTRAKAARDHFTKILARR
AYVDSMTSQIVNYVAKPGGKLSGEFRVPGDKSISHRSIMLGSLAEGTTEITGFLEGEDSL
ATLQSFRDMGVVIEGPHRGRVTVHGVGLHGLKTPPNALYLGNSGTSMRLLSGLMSAQSFD
VEMTGDVSLSKRPMDRVANPLREMGAVIESADKGRPPLKIKGGQPLKGIHYVLPMASAQV
KSCLLLAGLYAEGETTVIEPAPTRDHTERMLKGFGYPVDVDGPKVTVRPGGKLTATAIDV
PSDISSAAFFMVAASIAKDSDITLQHVGINPTRVGVINILRQMGANIEMLNESEVGGEPV
ADLRIRSAQLKGIQIPEDQVPLAIDEFPAIFIAAACAEGTTVLTGAEELRVKESDRIQAM
VEGMQALGVDAVGTEDGAIINGFGSEGSFNGGEVDSVDDHRIAMSFTIASLRANAPILIK
DCANVATSFPGFVELASESGIQVAVENA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory