SitesBLAST
Comparing WP_085120951.1 NCBI__GCF_900177295.1:WP_085120951.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
57% identity, 99% coverage: 3:258/258 of query aligns to 2:256/256 of 3h81A
- active site: A64 (= A65), M69 (= M70), T79 (≠ D80), F83 (≠ I84), G107 (= G109), E110 (= E112), P129 (= P131), E130 (= E132), V135 (≠ T137), P137 (= P139), G138 (= G140), L223 (= L225), F233 (= F235)
- binding calcium ion: F233 (= F235), Q238 (≠ R240)
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
58% identity, 98% coverage: 3:256/258 of query aligns to 3:258/260 of 1dubA
- active site: A68 (= A65), M73 (= M70), S83 (≠ D80), L87 (≠ I84), G111 (= G109), E114 (= E112), P133 (= P131), E134 (= E132), T139 (= T137), P141 (= P139), G142 (= G140), K227 (≠ L225), F237 (= F235)
- binding acetoacetyl-coenzyme a: K26 (= K23), A27 (= A24), L28 (= L25), A30 (= A27), A66 (= A63), A68 (= A65), D69 (= D66), I70 (= I67), Y107 (≠ F105), G110 (= G108), G111 (= G109), E114 (= E112), P133 (= P131), E134 (= E132), L137 (= L135), G142 (= G140), F233 (= F231), F249 (= F247)
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
58% identity, 98% coverage: 3:256/258 of query aligns to 1:256/258 of 1ey3A
- active site: A66 (= A65), M71 (= M70), S81 (≠ D80), L85 (≠ I84), G109 (= G109), E112 (= E112), P131 (= P131), E132 (= E132), T137 (= T137), P139 (= P139), G140 (= G140), K225 (≠ L225), F235 (= F235)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (= K23), L26 (= L25), A28 (= A27), A64 (= A63), G65 (= G64), A66 (= A65), D67 (= D66), I68 (= I67), L85 (≠ I84), W88 (= W88), G109 (= G109), P131 (= P131), L135 (= L135), G140 (= G140)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
58% identity, 98% coverage: 3:256/258 of query aligns to 33:288/290 of P14604
- E144 (= E112) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (= E132) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
57% identity, 99% coverage: 1:255/258 of query aligns to 1:254/255 of 3q0jC
- active site: A65 (= A65), M70 (= M70), T80 (≠ D80), F84 (≠ I84), G108 (= G109), E111 (= E112), P130 (= P131), E131 (= E132), V136 (≠ T137), P138 (= P139), G139 (= G140), L224 (= L225), F234 (= F235)
- binding acetoacetyl-coenzyme a: Q23 (≠ K23), A24 (= A24), L25 (= L25), A27 (= A27), A63 (= A63), G64 (= G64), A65 (= A65), D66 (= D66), I67 (= I67), K68 (= K68), M70 (= M70), F84 (≠ I84), G107 (= G108), G108 (= G109), E111 (= E112), P130 (= P131), E131 (= E132), P138 (= P139), G139 (= G140), M140 (≠ A141)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
57% identity, 99% coverage: 1:255/258 of query aligns to 1:254/255 of 3q0gC
- active site: A65 (= A65), M70 (= M70), T80 (≠ D80), F84 (≠ I84), G108 (= G109), E111 (= E112), P130 (= P131), E131 (= E132), V136 (≠ T137), P138 (= P139), G139 (= G140), L224 (= L225), F234 (= F235)
- binding coenzyme a: L25 (= L25), A63 (= A63), I67 (= I67), K68 (= K68), Y104 (≠ F105), P130 (= P131), E131 (= E132), L134 (= L135)
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
57% identity, 98% coverage: 3:256/258 of query aligns to 2:252/254 of 2dubA
- active site: A67 (= A65), M72 (= M70), S82 (≠ D80), G105 (= G109), E108 (= E112), P127 (= P131), E128 (= E132), T133 (= T137), P135 (= P139), G136 (= G140), K221 (≠ L225), F231 (= F235)
- binding octanoyl-coenzyme a: K25 (= K23), A26 (= A24), L27 (= L25), A29 (= A27), A65 (= A63), A67 (= A65), D68 (= D66), I69 (= I67), K70 (= K68), G105 (= G109), E108 (= E112), P127 (= P131), E128 (= E132), G136 (= G140), A137 (= A141)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
58% identity, 99% coverage: 3:258/258 of query aligns to 3:260/260 of 2hw5C
- active site: A68 (= A65), M73 (= M70), S83 (≠ D80), L87 (≠ I84), G111 (= G109), E114 (= E112), P133 (= P131), E134 (= E132), T139 (= T137), P141 (= P139), G142 (= G140), K227 (≠ L225), F237 (= F235)
- binding crotonyl coenzyme a: K26 (= K23), A27 (= A24), L28 (= L25), A30 (= A27), K62 (= K59), I70 (= I67), F109 (≠ L107)
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
57% identity, 98% coverage: 3:256/258 of query aligns to 3:256/258 of 1mj3A
- active site: A68 (= A65), M73 (= M70), S83 (≠ D80), L85 (≠ T85), G109 (= G109), E112 (= E112), P131 (= P131), E132 (= E132), T137 (= T137), P139 (= P139), G140 (= G140), K225 (≠ L225), F235 (= F235)
- binding hexanoyl-coenzyme a: K26 (= K23), A27 (= A24), L28 (= L25), A30 (= A27), A66 (= A63), G67 (= G64), A68 (= A65), D69 (= D66), I70 (= I67), G109 (= G109), P131 (= P131), E132 (= E132), L135 (= L135), G140 (= G140)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
57% identity, 98% coverage: 3:255/258 of query aligns to 2:249/250 of 3q0gD
- active site: A64 (= A65), M69 (= M70), T75 (≠ D80), F79 (≠ I84), G103 (= G109), E106 (= E112), P125 (= P131), E126 (= E132), V131 (≠ T137), P133 (= P139), G134 (= G140), L219 (= L225), F229 (= F235)
- binding Butyryl Coenzyme A: F225 (= F231), F241 (= F247)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
43% identity, 100% coverage: 1:258/258 of query aligns to 1:259/259 of 5zaiC
- active site: A65 (= A65), F70 (≠ M70), S82 (≠ I84), R86 (≠ W88), G110 (= G109), E113 (= E112), P132 (= P131), E133 (= E132), I138 (≠ T137), P140 (= P139), G141 (= G140), A226 (≠ L225), F236 (= F235)
- binding coenzyme a: K24 (≠ A24), L25 (= L25), A63 (= A63), G64 (= G64), A65 (= A65), D66 (= D66), I67 (= I67), P132 (= P131), R166 (≠ M165), F248 (= F247), K251 (= K250)
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
35% identity, 97% coverage: 8:258/258 of query aligns to 9:261/261 of 5jbxB
- active site: A67 (= A65), R72 (≠ M70), L84 (≠ I84), R88 (≠ W88), G112 (= G109), E115 (= E112), T134 (≠ P131), E135 (= E132), I140 (≠ T137), P142 (= P139), G143 (= G140), A228 (≠ L225), L238 (≠ F235)
- binding coenzyme a: S24 (≠ K23), R25 (≠ A24), R26 (≠ L25), A28 (= A27), A65 (= A63), D68 (= D66), L69 (≠ I67), K70 (= K68), L110 (= L107), G111 (= G108), T134 (≠ P131), E135 (= E132), L138 (= L135), R168 (≠ M165)
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
36% identity, 98% coverage: 6:258/258 of query aligns to 2:245/245 of 6slaAAA
- active site: Q61 (≠ A65), L68 (≠ E72), N72 (≠ A76), A96 (≠ G109), S99 (≠ E112), A118 (≠ P131), F119 (≠ E132), L124 (≠ T137), P126 (= P139), N127 (≠ G140), A212 (≠ L225), G222 (≠ F235)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (= L25), A59 (= A63), Q61 (≠ A65), D62 (= D66), L63 (≠ I67), L68 (≠ E72), Y71 (= Y75), A94 (≠ L107), G95 (= G108), A96 (≠ G109), F119 (≠ E132), I122 (≠ L135), L124 (≠ T137), N127 (≠ G140), F234 (= F247), K237 (= K250)
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
36% identity, 98% coverage: 5:258/258 of query aligns to 9:266/266 of O53561
- K135 (≠ R127) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 127:134, 50% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (= K134) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
35% identity, 98% coverage: 6:258/258 of query aligns to 5:257/257 of 6slbAAA
- active site: Q64 (≠ A65), F69 (≠ M70), L80 (≠ E81), N84 (≠ T85), A108 (≠ G109), S111 (≠ E112), A130 (≠ P131), F131 (≠ E132), L136 (≠ T137), P138 (= P139), D139 (≠ G140), A224 (≠ L225), G234 (≠ F235)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ K59), A62 (= A63), Q64 (≠ A65), D65 (= D66), L66 (≠ I67), Y76 (≠ D77), A108 (≠ G109), F131 (≠ E132), D139 (≠ G140)
3p85A Crystal structure enoyl-coa hydratase from mycobacterium avium (see paper)
35% identity, 83% coverage: 14:227/258 of query aligns to 11:210/224 of 3p85A
- active site: L62 (≠ A65), L67 (≠ M70), P68 (≠ K71), G92 (= G109), E95 (= E112), T114 (≠ P131), H115 (≠ E132), L120 (≠ T137), P122 (= P139), T123 (≠ G140), W208 (≠ L225)
- binding calcium ion: D43 (= D46), D45 (≠ A48)
Sites not aligning to the query:
4elxA Structure of apo e.Coli. 1,4-dihydroxy-2- naphthoyl coa synthases with cl (see paper)
34% identity, 98% coverage: 2:255/258 of query aligns to 18:261/268 of 4elxA
- active site: G83 (≠ A65), H88 (≠ Y75), L92 (= L79), G116 (= G109), V119 (≠ E112), G139 (≠ E132), S144 (≠ T137), D146 (≠ P139), G147 (= G140), A233 (≠ F226), Y241 (≠ F235)
- binding chloride ion: G115 (= G108), G139 (≠ E132), W167 (≠ C160)
Q13825 Methylglutaconyl-CoA hydratase, mitochondrial; 3-MG-CoA hydratase; AU-specific RNA-binding enoyl-CoA hydratase; AU-binding protein/enoyl-CoA hydratase; Itaconyl-CoA hydratase; EC 4.2.1.18; EC 4.2.1.56 from Homo sapiens (Human) (see 4 papers)
38% identity, 96% coverage: 9:256/258 of query aligns to 85:337/339 of Q13825
- K105 (≠ T30) mutation to N: Abolishes RNA-binding; when associated with E-109 and Q-113.
- 105:119 (vs. 30:44, 33% identical) RNA-binding
- K109 (≠ D34) mutation to E: Abolishes RNA-binding; when associated with N-105 and Q-113.
- K113 (≠ Q38) mutation to Q: Abolishes RNA-binding; when associated with N-105 and E-109.
- A240 (≠ G163) to V: in MGCA1; decreased methylglutaconyl-CoA hydratase activity; dbSNP:rs769894315
Sites not aligning to the query:
- 1:67 modified: transit peptide, Mitochondrion
4elwA Structure of e. Coli. 1,4-dihydroxy-2- naphthoyl coenzyme a synthases (menb) in complex with nitrate (see paper)
34% identity, 98% coverage: 2:255/258 of query aligns to 18:260/267 of 4elwA
- active site: G83 (≠ A65), L91 (= L79), G115 (= G109), V118 (≠ E112), G138 (≠ E132), S143 (≠ T137), D145 (≠ P139), G146 (= G140), A232 (≠ F226), Y240 (≠ F235)
- binding nitrate ion: G114 (= G108), T137 (≠ P131), G138 (≠ E132), F144 (≠ I138), W166 (≠ C160)
3h02A 2.15 angstrom resolution crystal structure of naphthoate synthase from salmonella typhimurium.
33% identity, 98% coverage: 2:255/258 of query aligns to 17:259/266 of 3h02A
- active site: G82 (≠ A65), H86 (≠ Y75), L90 (= L79), G114 (= G109), V117 (≠ E112), G137 (≠ E132), S142 (≠ T137), D144 (≠ P139), G145 (= G140), A231 (≠ F226), Y239 (≠ F235)
- binding bicarbonate ion: G113 (= G108), Q135 (= Q130), G137 (≠ E132), W165 (≠ C160)
Query Sequence
>WP_085120951.1 NCBI__GCF_900177295.1:WP_085120951.1
MAFEDILVERKGAVGVVTLNRPKALNALCTPLIDELGQALAELEADEAIRCIVLTGSEKA
FAAGADIKEMKEKSYADVLDEDFITGDWEVVAHCRKPTIAAVAGFALGGGCEVAMMCDMI
LAAETARFGQPEIKLGTIPGAGGTQRLTRSVGKSLAMYLCLSGDMIDAETALRAGLVAKV
LPAEGFLDEVMKVAETIASYSLPVLRTCKEAVNRAYETTLAEGVLFERRTFHGTFALEDR
KEGMEAFAEKRKPNFKHR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory