Comparing WP_085122085.1 NCBI__GCF_900177295.1:WP_085122085.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
2eb6A Crystal structure of hpcg complexed with mg ion (see paper)
51% identity, 96% coverage: 11:259/260 of query aligns to 11:266/267 of 2eb6A
P42270 2-oxo-hept-4-ene-1,7-dioate hydratase; OHED hydratase; EC 4.2.1.163 from Escherichia coli (see paper)
51% identity, 96% coverage: 11:259/260 of query aligns to 11:266/267 of P42270
2eb5A Crystal structure of hpcg complexed with oxalate (see paper)
50% identity, 100% coverage: 1:259/260 of query aligns to 1:258/259 of 2eb5A
5d2kA 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with magnesium and 2-oxoadipate (see paper)
37% identity, 90% coverage: 26:259/260 of query aligns to 28:262/263 of 5d2kA
5d2jA 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with magnesium and adipate (see paper)
37% identity, 90% coverage: 26:259/260 of query aligns to 28:262/263 of 5d2jA
5d2iA 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with calcium and acetate (see paper)
37% identity, 90% coverage: 26:259/260 of query aligns to 28:262/263 of 5d2iA
5d2hA 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with magnesium and alpha-ketoglutarate (see paper)
37% identity, 90% coverage: 26:259/260 of query aligns to 28:262/263 of 5d2hA
5d2gA 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with magnesium (see paper)
37% identity, 90% coverage: 26:259/260 of query aligns to 28:262/263 of 5d2gA
>WP_085122085.1 NCBI__GCF_900177295.1:WP_085122085.1
MLTDAERQAAADSLLKAGETRVVVPQLSKTYPGMTIEDAYDVQRRWAAGRIAKGAKVAGR
KIGLTSRAMQMASRMTEPDYGLILDDALFNDGARIPAGTFIKPRLETELAFVMGENLSGA
GCRVHDVMRATEYVTPALEIIDYRTEVPRQIVDTIADNAAFGAIVLGGRIVEPFEVDVRW
IGATLSKNGIIEESGVSAAVMGHPAAGIAWLVNKLAPLGDGLKKGEVVLGGSFTRPVDIA
SGDVIQADYGPLGAIGVSFA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory