SitesBLAST
Comparing WP_085218433.1 NCBI__GCF_900177405.1:WP_085218433.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2pg0A Crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus
53% identity, 97% coverage: 13:380/380 of query aligns to 8:378/380 of 2pg0A
- active site: M124 (= M128), T125 (= T129), E243 (= E245), A364 (≠ G366), R376 (= R378)
- binding flavin-adenine dinucleotide: I122 (= I126), M124 (= M128), T125 (= T129), G130 (= G134), S131 (= S135), F155 (≠ Y159), I156 (= I160), T157 (= T161), R269 (= R271), F272 (= F274), F279 (= F281), Q337 (= Q339), L338 (= L340), G340 (= G342), G341 (= G343), V359 (= V361), I362 (= I364), Y363 (≠ F365), T366 (= T368), E368 (= E370), M369 (≠ I371)
P51174 Long-chain specific acyl-CoA dehydrogenase, mitochondrial; LCAD; EC 1.3.8.8 from Mus musculus (Mouse) (see paper)
49% identity, 100% coverage: 1:380/380 of query aligns to 44:426/430 of P51174
- K318 (= K272) modified: N6-acetyllysine; mutation to R: Reduces activity by 37%; reduces activity by 80% when associated with R-322.
- K322 (= K276) modified: N6-acetyllysine; alternate; mutation to R: Reduces activity by 23%; reduces activity by 80% when associated with R-318.
Sites not aligning to the query:
- 42 modified: N6-acetyllysine; K→R: Reduces activity by 90% when associated with R-318 and R-322.
8w0uA Human lcad complexed with acetoacetyl coenzyme a (see paper)
48% identity, 99% coverage: 1:378/380 of query aligns to 12:392/398 of 8w0uA
- binding acetoacetyl-coenzyme a: M140 (= M128), S147 (= S135), Q150 (= Q138), S193 (= S178), H196 (≠ K182), Y250 (≠ A236), E259 (= E245), R260 (= R246), Y379 (≠ F365), G380 (= G366), G381 (= G367), I385 (= I371), L389 (≠ V375), R392 (= R378)
- binding flavin-adenine dinucleotide: I138 (= I126), M140 (= M128), T141 (= T129), G146 (= G134), S147 (= S135), F171 (≠ Y159), S173 (≠ T161), R285 (= R271), F288 (= F274), L295 (≠ F281), Q353 (= Q339), L354 (= L340), G357 (= G343), V375 (= V361), Y379 (≠ F365), T382 (= T368), E384 (= E370)
8w0tA Human lcad (see paper)
48% identity, 99% coverage: 1:378/380 of query aligns to 12:392/398 of 8w0tA
- binding flavin-adenine dinucleotide: I138 (= I126), M140 (= M128), T141 (= T129), G146 (= G134), S147 (= S135), F171 (≠ Y159), I172 (= I160), S173 (≠ T161), R285 (= R271), F288 (= F274), L295 (≠ F281), Q353 (= Q339), L354 (= L340), G356 (= G342), G357 (= G343), V375 (= V361), T382 (= T368), E384 (= E370), I385 (= I371)
P28330 Long-chain specific acyl-CoA dehydrogenase, mitochondrial; LCAD; EC 1.3.8.8 from Homo sapiens (Human) (see 2 papers)
48% identity, 99% coverage: 1:378/380 of query aligns to 44:424/430 of P28330
- E291 (= E245) active site, Proton acceptor; mutation to Q: Loss of long-chain-acyl-CoA dehydrogenase activity. No effect on protein abundance. No effect on solubility. No effect on substrate binding.
- S303 (≠ A257) to T: in dbSNP:rs1801204
- K333 (≠ T287) to Q: in dbSNP:rs2286963
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
37% identity, 96% coverage: 16:380/380 of query aligns to 11:377/380 of 4l1fA
- active site: L125 (≠ M128), T126 (= T129), G242 (≠ E245), E363 (≠ G366), R375 (= R378)
- binding coenzyme a persulfide: T132 (≠ S135), H179 (≠ K182), F232 (= F235), M236 (= M239), E237 (≠ N240), L239 (= L242), D240 (≠ P243), R243 (= R246), Y362 (≠ F365), E363 (≠ G366), G364 (= G367), R375 (= R378)
- binding flavin-adenine dinucleotide: F123 (≠ I126), L125 (≠ M128), T126 (= T129), G131 (= G134), T132 (≠ S135), F156 (≠ Y159), I157 (= I160), T158 (= T161), R268 (= R271), Q270 (≠ A273), F271 (= F274), I275 (≠ V278), F278 (= F281), L281 (≠ T284), Q336 (= Q339), I337 (≠ L340), G340 (= G343), I358 (≠ V361), Y362 (≠ F365), T365 (= T368), Q367 (≠ E370)
Sites not aligning to the query:
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
38% identity, 96% coverage: 13:376/380 of query aligns to 7:372/378 of 5ol2F
- active site: L124 (≠ M128), T125 (= T129), G241 (≠ E245)
- binding calcium ion: E29 (≠ R35), E33 (= E39), R35 (≠ I41)
- binding coenzyme a persulfide: L238 (= L242), R242 (= R246), E362 (≠ G366), G363 (= G367)
- binding flavin-adenine dinucleotide: F122 (≠ I126), L124 (≠ M128), T125 (= T129), P127 (= P131), T131 (≠ S135), F155 (≠ Y159), I156 (= I160), T157 (= T161), E198 (≠ L202), R267 (= R271), F270 (= F274), L274 (≠ V278), F277 (= F281), Q335 (= Q339), L336 (= L340), G338 (= G342), G339 (= G343), Y361 (≠ F365), T364 (= T368), E366 (= E370)
Sites not aligning to the query:
3r7kA Crystal structure of a probable acyl coa dehydrogenase from mycobacterium abscessus atcc 19977 / dsm 44196 (see paper)
39% identity, 94% coverage: 22:378/380 of query aligns to 17:375/378 of 3r7kA
- active site: V126 (≠ M128), T127 (= T129), E242 (= E245), G363 (= G366), K375 (≠ R378)
- binding dihydroflavine-adenine dinucleotide: V126 (≠ M128), T127 (= T129), G132 (= G134), S133 (= S135), F157 (≠ Y159), I158 (= I160), T159 (= T161), R268 (= R271), T270 (≠ A273), F271 (= F274), L275 (≠ V278), R278 (≠ F281), I281 (≠ T284), Q336 (= Q339), I337 (≠ L340), G340 (= G343), I358 (≠ V361), T365 (= T368), E367 (= E370)
6fahD Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
36% identity, 97% coverage: 10:376/380 of query aligns to 3:372/379 of 6fahD
- active site: L124 (≠ M128), T125 (= T129), G241 (≠ E245)
- binding flavin-adenine dinucleotide: F122 (≠ I126), L124 (≠ M128), T125 (= T129), R152 (≠ S156), F155 (≠ Y159), T157 (= T161), E198 (≠ L202), R267 (= R271), Q269 (≠ A273), F270 (= F274), I274 (≠ V278), F277 (= F281), Q335 (= Q339), I336 (≠ L340), G339 (= G343), Y361 (≠ F365), T364 (= T368), Q366 (≠ E370)
Sites not aligning to the query:
4iv6B X-ray crystal structure of an isovaleryl-coa dehydrogenase from mycobacterium smegmatis (see paper)
40% identity, 98% coverage: 9:380/380 of query aligns to 1:375/383 of 4iv6B
- active site: L121 (≠ M128), T122 (= T129), G240 (≠ E245), E361 (≠ G366), K373 (≠ R378)
- binding dihydroflavine-adenine dinucleotide: L121 (≠ M128), T122 (= T129), G126 (≠ A133), G127 (= G134), S128 (= S135), W152 (≠ Y159), I153 (= I160), S154 (≠ T161), R266 (= R271), S268 (≠ A273), F269 (= F274), I273 (≠ V278), H276 (≠ F281), V279 (≠ T284), R334 (≠ Q339), V335 (≠ L340), G338 (= G343), L356 (≠ V361), G360 (≠ F365), T363 (= T368), E365 (= E370), I366 (= I371)
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
38% identity, 96% coverage: 16:380/380 of query aligns to 12:378/378 of 4n5fA
- active site: L126 (≠ M128), T127 (= T129), G243 (≠ E245), E364 (≠ G366), R376 (= R378)
- binding dihydroflavine-adenine dinucleotide: L126 (≠ M128), T127 (= T129), G132 (= G134), S133 (= S135), F157 (≠ Y159), T159 (= T161), T210 (= T212), Y363 (≠ F365), T366 (= T368), E368 (= E370), M372 (≠ E374)
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
36% identity, 94% coverage: 22:378/380 of query aligns to 17:374/379 of 1ukwB
- active site: L124 (≠ M128), S125 (≠ T129), T241 (≠ E245), E362 (≠ G366), R374 (= R378)
- binding cobalt (ii) ion: D145 (= D149), H146 (≠ S150)
- binding flavin-adenine dinucleotide: F122 (≠ I126), L124 (≠ M128), S125 (≠ T129), G130 (= G134), S131 (= S135), W155 (≠ Y159), S157 (≠ T161), K200 (= K204), L357 (≠ V361), Y361 (≠ F365), E362 (≠ G366), T364 (= T368), E366 (= E370), L370 (≠ E374)
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
36% identity, 94% coverage: 22:378/380 of query aligns to 17:374/379 of 1ukwA
- active site: L124 (≠ M128), S125 (≠ T129), T241 (≠ E245), E362 (≠ G366), R374 (= R378)
- binding flavin-adenine dinucleotide: F122 (≠ I126), L124 (≠ M128), S125 (≠ T129), G130 (= G134), S131 (= S135), W155 (≠ Y159), S157 (≠ T161), L357 (≠ V361), Y361 (≠ F365), E362 (≠ G366), T364 (= T368), E366 (= E370), L370 (≠ E374)
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
37% identity, 97% coverage: 13:380/380 of query aligns to 5:372/374 of 5lnxD
- active site: L122 (≠ M128), T123 (= T129), G239 (≠ E245), E358 (≠ G366), K370 (≠ R378)
- binding flavin-adenine dinucleotide: L122 (≠ M128), T123 (= T129), G128 (= G134), S129 (= S135), F153 (≠ Y159), T155 (= T161), R265 (= R271), Q267 (≠ A273), F268 (= F274), I272 (≠ V278), N275 (≠ F281), I278 (≠ T284), Q331 (= Q339), I332 (≠ L340), G335 (= G343), Y357 (≠ F365), T360 (= T368), E362 (= E370)
3pfdC Crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr (see paper)
35% identity, 97% coverage: 14:380/380 of query aligns to 1:367/369 of 3pfdC
- active site: L116 (≠ M128), S117 (≠ T129), T233 (≠ E245), E353 (≠ G366), R365 (= R378)
- binding dihydroflavine-adenine dinucleotide: Y114 (≠ I126), L116 (≠ M128), S117 (≠ T129), G122 (= G134), S123 (= S135), W147 (≠ Y159), I148 (= I160), T149 (= T161), R259 (= R271), F262 (= F274), V266 (= V278), N269 (≠ F281), Q326 (= Q339), L327 (= L340), G330 (= G343), I348 (≠ V361), Y352 (≠ F365), T355 (= T368), Q357 (≠ E370)
8sgrA Human liver mitochondrial isovaleryl-coa dehydrogenase (see paper)
35% identity, 97% coverage: 11:378/380 of query aligns to 7:386/393 of 8sgrA
- binding flavin-adenine dinucleotide: S135 (≠ T129), G140 (= G134), S141 (= S135), W165 (≠ Y159), T167 (= T161), R279 (= R271), F282 (= F274), I286 (≠ V278), F289 (= F281), Q347 (= Q339), C348 (≠ L340), G351 (= G343), L369 (≠ V361), G375 (= G367), T376 (= T368), L382 (≠ E374)
1ivhA Structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity (see paper)
35% identity, 97% coverage: 11:378/380 of query aligns to 3:382/387 of 1ivhA
- active site: M130 (= M128), S131 (≠ T129), E249 (= E245), A370 (≠ G366), R382 (= R378)
- binding coenzyme a persulfide: S137 (= S135), S185 (≠ A181), R186 (≠ K182), V239 (≠ F235), Y240 (≠ A236), M243 (= M239), E249 (= E245), R250 (= R246), G369 (≠ F365), A370 (≠ G366), G371 (= G367), V375 (≠ I371)
- binding flavin-adenine dinucleotide: L128 (≠ I126), M130 (= M128), S131 (≠ T129), G136 (= G134), S137 (= S135), W161 (≠ Y159), T163 (= T161), R275 (= R271), F278 (= F274), F285 (= F281), M288 (≠ T284), Q343 (= Q339), C344 (≠ L340), G347 (= G343), T372 (= T368), E374 (= E370)
P26440 Isovaleryl-CoA dehydrogenase, mitochondrial; IVD; Butyryl-CoA dehydrogenase; EC 1.3.8.4; EC 1.3.8.1 from Homo sapiens (Human) (see 5 papers)
34% identity, 97% coverage: 11:380/380 of query aligns to 40:421/426 of P26440
- 165:174 (vs. 126:135, 70% identical) binding FAD
- S174 (= S135) binding substrate
- WIT 198:200 (≠ YIT 159:161) binding FAD
- SR 222:223 (≠ AK 181:182) binding substrate
- G250 (≠ S209) to A: in IVA; uncertain significance
- Y277 (≠ A236) binding substrate
- DLER 284:287 (≠ PQER 243:246) binding substrate
- E286 (= E245) active site, Proton acceptor; mutation to D: Residual isovaleryl-CoA dehydrogenase activity.; mutation to G: Loss of isovaleryl-CoA dehydrogenase activity. Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 407-E.; mutation to Q: Loss of isovaleryl-CoA dehydrogenase activity.
- A291 (= A250) to V: in IVA; uncertain significance; dbSNP:rs886042098
- R312 (= R271) binding FAD
- Q323 (= Q282) binding FAD
- I379 (≠ L338) to T: in IVA; uncertain significance
- QCFGG 380:384 (≠ QLHGG 339:343) binding FAD
- R398 (= R357) to Q: in IVA; uncertain significance; dbSNP:rs1477527791
- Y403 (≠ T362) to N: in IVA; uncertain significance
- A407 (≠ G366) mutation to E: Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 286-D.
- AG 407:408 (≠ GG 366:367) binding substrate
- TSE 409:411 (≠ TNE 368:370) binding FAD
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
7p9xA Structure of cyclohex-1-ene-1-carboxyl-coa dehydrogenase complexed with cyclohex-1-ene-1-carboxyl-coa (see paper)
37% identity, 97% coverage: 13:380/380 of query aligns to 5:375/378 of 7p9xA
- binding 1-monoenoyl-CoA: L82 (≠ I90), D89 (≠ V97), S129 (= S135), L131 (= L137), K176 (= K182), F229 (= F235), M233 (= M239), L236 (= L242), R240 (= R246), Y360 (≠ F365), T361 (≠ G366), G362 (= G367), R373 (= R378)
- binding flavin-adenine dinucleotide: A122 (≠ M128), T123 (= T129), G128 (= G134), S129 (= S135), F153 (≠ Y159), I154 (= I160), T155 (= T161), N206 (≠ T212), L356 (≠ V361), Y360 (≠ F365), T363 (= T368), Q365 (≠ E370), I366 (= I371)
7p9aA Structure of cyclohex-1-ene-1-carboxyl-coa dehydrogenase complexed with cyclohex-1,5-diene-1-carboxyl-coa (see paper)
37% identity, 97% coverage: 13:380/380 of query aligns to 7:377/380 of 7p9aA
- binding 1,5 Dienoyl-CoA: S131 (= S135), L133 (= L137), K178 (= K182), F231 (= F235), M235 (= M239), L238 (= L242), N241 (≠ E245), R242 (= R246), Y362 (≠ F365), T363 (≠ G366), G364 (= G367), R375 (= R378)
- binding flavin-adenine dinucleotide: L122 (≠ I126), A124 (≠ M128), T125 (= T129), G130 (= G134), S131 (= S135), F155 (≠ Y159), I156 (= I160), T157 (= T161), K200 (= K204), N208 (≠ T212), L358 (≠ V361), T365 (= T368), Q367 (≠ E370), I368 (= I371)
Query Sequence
>WP_085218433.1 NCBI__GCF_900177405.1:WP_085218433.1
MLDTARRTAFDAEHGLFRDQVRRFFDKALIPHLDRWEEEGIVDRDLWTQCGETGLLCPTV
PEEYGGLGLDFRYNAVIDEELAYAGSTAGITLHSDIVADYIVVYGSEAQKQHWLPRMISG
ETPTAIAMTEPGAGSDLQGVRTTAIRDGDSYVINGSKTYITNGQHADLVIVVAKTDPSQG
AKGTSLILVEADREGFARGRNLDKIGLHSQDTSEMFFNDVRVPADNLLGQEGAGFAYLMN
QLPQERLSIACSAQGAAQRAFDEALAFTRDRKAFGKSVLDFQNTRFTLADLATKLQVGWA
HLDWAITRHVAGELTATEASAAKLWHTELQGEACDTALQLHGGAGYMNEYLIARLWRDAR
VTRIFGGTNEIMKEVIGRGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory