Comparing WP_085635098.1 NCBI__GCF_002115805.1:WP_085635098.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
39% identity, 92% coverage: 17:280/287 of query aligns to 405:705/714 of Q8ZND6
Sites not aligning to the query:
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
39% identity, 94% coverage: 11:280/287 of query aligns to 15:330/339 of 6ioxA
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
37% identity, 95% coverage: 12:284/287 of query aligns to 15:324/325 of 1xcoD
6zngF Maeb full-length acetyl-coa bound state (see paper)
33% identity, 98% coverage: 4:285/287 of query aligns to 426:744/753 of 6zngF
Sites not aligning to the query:
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
30% identity, 98% coverage: 1:280/287 of query aligns to 2:324/333 of P38503
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
30% identity, 98% coverage: 1:280/287 of query aligns to 1:323/332 of 2af3C
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
28% identity, 99% coverage: 3:285/287 of query aligns to 434:755/759 of P76558
Sites not aligning to the query:
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
26% identity, 54% coverage: 132:286/287 of query aligns to 127:288/288 of 3u9eB
Sites not aligning to the query:
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
26% identity, 54% coverage: 132:285/287 of query aligns to 125:285/285 of 3uf6A
Sites not aligning to the query:
>WP_085635098.1 NCBI__GCF_002115805.1:WP_085635098.1
MSVLDKARAAAAGSQTRVVFPERDDPRVADAAQRLTADGLCIALDVSEDITEAQVAALVS
ARGMKEALACRLLQKPLYRAAAMVAAGEADAMVAGADSPTRRVIEAASMAIGLAEGVAIP
SSYFLMVFPDGRELVFADCAVNVDPDAAALEAIARASADTAKALLGDARVALLSFSTGTS
GAGDSVERVRAVAEATGFAGPVQADAALNATIAAKKGLGSGDANVLVFPSLDAGNIAYKL
CQELGGAQAIGPFLQGFARPVCDLSRGATVDDIVASTLVTIALAQRA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory