SitesBLAST
Comparing WP_085635947.1 NCBI__GCF_002115805.1:WP_085635947.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3i6eA Crystal structure of muconate lactonizing enzyme from ruegeria pomeroyi.
69% identity, 98% coverage: 4:373/377 of query aligns to 1:356/356 of 3i6eA
- active site: S124 (= S141), K149 (= K166), K151 (= K168), D179 (= D196), Y180 (≠ F197), N181 (= N198), Q182 (= Q199), E205 (= E222), D230 (= D247), E231 (= E248), S232 (= S249), K254 (= K271), Y279 (= Y296), G281 (= G298), D282 (= D299), M283 (= M300), C307 (= C324), E308 (= E325), F309 (= F326)
- binding magnesium ion: D179 (= D196), E205 (= E222), D230 (= D247)
3i6tB Crystal structure of muconate cycloisomerase from jannaschia sp.
69% identity, 97% coverage: 6:371/377 of query aligns to 1:364/364 of 3i6tB
- active site: R19 (= R24), S136 (= S141), K161 (= K166), K163 (= K168), D191 (= D196), N193 (= N198), E217 (= E222), D242 (= D247), E243 (= E248), S262 (= S269), K264 (= K271), G291 (= G298), D292 (= D299), M293 (= M300), C317 (= C324), E318 (= E325), F319 (= F326)
- binding magnesium ion: D191 (= D196), E217 (= E222), D242 (= D247)
3my9A Crystal structure of a muconate cycloisomerase from azorhizobium caulinodans
43% identity, 87% coverage: 33:359/377 of query aligns to 21:343/357 of 3my9A
- active site: P44 (= P56), W45 (= W57), S124 (= S141), K149 (= K166), K151 (= K168), D180 (= D196), N182 (= N198), E206 (= E222), D231 (= D247), E232 (= E248), S233 (= S249), S253 (= S269), K255 (= K271), G282 (= G298), T283 (≠ D299), L284 (≠ M300), C308 (= C324), E309 (= E325), F310 (= F326)
- binding magnesium ion: E206 (= E222), A221 (≠ R237), L224 (≠ I240), D231 (= D247)
3fcpA Crystal structure of muconate lactonizing enzyme from klebsiella pneumoniae
34% identity, 89% coverage: 35:369/377 of query aligns to 19:353/356 of 3fcpA
- active site: T41 (≠ P56), G44 (≠ V59), T129 (≠ S141), K151 (= K166), K153 (= K168), D182 (= D196), N184 (= N198), E208 (= E222), D233 (= D247), E234 (= E248), A235 (≠ S249), K257 (= K271), G284 (= G298), T285 (≠ D299), M286 (= M300), T309 (≠ C324), E310 (= E325), M311 (≠ F326)
- binding magnesium ion: N184 (= N198), D233 (= D247), E234 (= E248)
3i4kA Crystal structure of muconate lactonizing enzyme from corynebacterium glutamicum
31% identity, 94% coverage: 16:369/377 of query aligns to 12:368/370 of 3i4kA
- active site: H20 (= H26), V51 (vs. gap), G54 (≠ S55), G87 (≠ A89), A139 (≠ S141), K165 (= K166), K167 (= K168), D196 (= D196), N198 (= N198), E222 (= E222), D247 (= D247), E248 (= E248), S249 (= S249), A269 (≠ S269), K271 (= K271), T272 (≠ I272), A298 (≠ G298), T299 (≠ D299), S300 (≠ M300), T324 (≠ C324), E325 (= E325), L326 (≠ F326)
- binding magnesium ion: D196 (= D196), E222 (= E222), D247 (= D247)
1tkkA The structure of a substrate-liganded complex of the l-ala-d/l-glu epimerase from bacillus subtilis (see paper)
29% identity, 86% coverage: 34:359/377 of query aligns to 28:354/359 of 1tkkA
- active site: P50 (= P56), V53 (= V59), T135 (≠ S141), K160 (= K166), K162 (= K168), L190 (≠ V195), D191 (= D196), A192 (≠ F197), N193 (= N198), E219 (= E222), D244 (= D247), E245 (= E248), S246 (= S249), N266 (≠ S269), K268 (= K271), G295 (= G298), S296 (≠ D299), M297 (= M300), F320 (= F326), D321 (vs. gap), F322 (≠ Y327)
- binding alanine: K160 (= K166), K162 (= K168), D321 (vs. gap), D323 (≠ Q328)
- binding glutamic acid: K160 (= K166), D191 (= D196), K268 (= K271), S296 (≠ D299), M297 (= M300), I298 (≠ F301)
- binding magnesium ion: D191 (= D196), E219 (= E222), D244 (= D247)
Sites not aligning to the query:
1jpmA L-ala-d/l-glu epimerase (see paper)
29% identity, 86% coverage: 34:359/377 of query aligns to 28:354/359 of 1jpmA
- active site: P50 (= P56), V53 (= V59), T135 (≠ S141), K160 (= K166), K162 (= K168), L190 (≠ V195), D191 (= D196), A192 (≠ F197), N193 (= N198), E219 (= E222), D244 (= D247), E245 (= E248), S246 (= S249), N266 (≠ S269), K268 (= K271), G295 (= G298), S296 (≠ D299), M297 (= M300), F320 (= F326), D321 (vs. gap), F322 (≠ Y327)
- binding magnesium ion: D191 (= D196), E219 (= E222), D244 (= D247)
Sites not aligning to the query:
O34508 L-Ala-D/L-Glu epimerase; AE epimerase; AEE; EC 5.1.1.20 from Bacillus subtilis (strain 168) (see 2 papers)
28% identity, 94% coverage: 7:359/377 of query aligns to 2:354/366 of O34508
- R24 (= R30) binding substrate
- T135 (≠ S141) binding substrate
- K160 (= K166) binding substrate
- K162 (= K168) active site, Proton acceptor; specific for (R)-substrate epimerization
- D191 (= D196) binding Mg(2+)
- E219 (= E222) binding Mg(2+)
- D244 (= D247) binding Mg(2+)
- K268 (= K271) active site, Proton acceptor; specific for (S)-substrate epimerization
- S296 (≠ D299) binding substrate
- I298 (≠ F301) binding substrate
- D321 (vs. gap) binding substrate
- D323 (≠ Q328) binding substrate
3dgbA Crystal structure of muconate lactonizing enzyme from pseudomonas fluorescens complexed with muconolactone (see paper)
32% identity, 88% coverage: 37:369/377 of query aligns to 33:369/371 of 3dgbA
- active site: T52 (≠ P56), G55 (vs. gap), T140 (≠ S141), K166 (= K166), K168 (= K168), D197 (= D196), N199 (= N198), E223 (= E222), D248 (= D247), E249 (= E248), S250 (= S249), I251 (≠ V250), K272 (= K271), Y297 (= Y296), G299 (= G298), T300 (≠ D299), M301 (= M300), H313 (= H312), T325 (≠ C324), E326 (= E325), L327 (≠ F326)
- binding magnesium ion: D197 (= D196), E223 (= E222), D248 (= D247)
- binding [(2S)-5-oxo-2,5-dihydrofuran-2-yl]acetic acid: I53 (vs. gap), Y58 (≠ V59), T140 (≠ S141), K166 (= K166), K168 (= K168), D197 (= D196), K272 (= K271), T300 (≠ D299), E326 (= E325), F328 (≠ Y327)
Sites not aligning to the query:
1f9cA Crystal structure of mle d178n variant (see paper)
30% identity, 88% coverage: 37:369/377 of query aligns to 22:358/360 of 1f9cA
- active site: T41 (≠ P56), G44 (vs. gap), T129 (≠ S141), K155 (= K166), K157 (= K168), D186 (= D196), N188 (= N198), E212 (= E222), D237 (= D247), E238 (= E248), S239 (= S249), K261 (= K271), G288 (= G298), T289 (≠ D299), M290 (= M300), T314 (≠ C324), E315 (= E325), L316 (≠ F326)
- binding manganese (ii) ion: D186 (= D196), E212 (= E222), D237 (= D247)
2p8cA Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 complexed with n-succinyl arg. (see paper)
29% identity, 89% coverage: 38:371/377 of query aligns to 32:363/369 of 2p8cA
- active site: A50 (≠ P56), H53 (≠ V59), V136 (vs. gap), F160 (≠ V165), K161 (= K166), M162 (≠ L167), K163 (= K168), D191 (= D196), N193 (= N198), E218 (= E222), D243 (= D247), E244 (= E248), G245 (≠ S249), N265 (≠ S269), K267 (= K271), G294 (= G298), S295 (≠ D299), M296 (= M300), V319 (≠ C324), E320 (= E325), L321 (≠ F326)
- binding magnesium ion: D191 (= D196), E218 (= E222), D243 (= D247)
- binding n~2~-(3-carboxypropanoyl)-l-arginine: D51 (≠ W57), K163 (= K168), D191 (= D196), D243 (= D247), K267 (= K271), S295 (≠ D299), M296 (= M300), E320 (= E325), L321 (≠ F326), T322 (≠ Q328)
Sites not aligning to the query:
2p8bA Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 complexed with n-succinyl lys. (see paper)
29% identity, 89% coverage: 38:371/377 of query aligns to 32:363/369 of 2p8bA
- active site: A50 (≠ P56), H53 (≠ V59), V136 (vs. gap), F160 (≠ V165), K161 (= K166), M162 (≠ L167), K163 (= K168), D191 (= D196), N193 (= N198), E218 (= E222), D243 (= D247), E244 (= E248), G245 (≠ S249), N265 (≠ S269), K267 (= K271), G294 (= G298), S295 (≠ D299), M296 (= M300), V319 (≠ C324), E320 (= E325), L321 (≠ F326)
- binding magnesium ion: D191 (= D196), E218 (= E222), D243 (= D247)
- binding n-succinyl lysine: D51 (≠ W57), V136 (vs. gap), K161 (= K166), K163 (= K168), D243 (= D247), K267 (= K271), S295 (≠ D299), M296 (= M300), E320 (= E325), L321 (≠ F326), T322 (≠ Q328)
Sites not aligning to the query:
2p88A Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 (see paper)
29% identity, 89% coverage: 38:371/377 of query aligns to 32:363/369 of 2p88A
- active site: A50 (≠ P56), H53 (≠ V59), V136 (vs. gap), F160 (≠ V165), K161 (= K166), M162 (≠ L167), K163 (= K168), D191 (= D196), N193 (= N198), E218 (= E222), D243 (= D247), E244 (= E248), G245 (≠ S249), N265 (≠ S269), K267 (= K271), G294 (= G298), S295 (≠ D299), M296 (= M300), V319 (≠ C324), E320 (= E325), L321 (≠ F326)
- binding magnesium ion: D191 (= D196), E218 (= E222), D243 (= D247)
Sites not aligning to the query:
Q81IL5 N-succinyl-L-Arg/Lys racemase; N-succinyl amino acid racemase; NSAR; EC 5.1.1.- from Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) (see paper)
29% identity, 89% coverage: 38:371/377 of query aligns to 32:363/369 of Q81IL5
- D191 (= D196) binding Mg(2+)
- E218 (= E222) binding Mg(2+)
- D243 (= D247) binding Mg(2+)
1nu5A Crystal structure of pseudomonas sp. P51 chloromuconate lactonizing enzyme (see paper)
29% identity, 81% coverage: 63:369/377 of query aligns to 59:366/369 of 1nu5A
- active site: T137 (≠ S141), K163 (= K166), K165 (= K168), E176 (≠ M179), D194 (= D196), N196 (= N198), E220 (= E222), D245 (= D247), E246 (= E248), S247 (= S249), K269 (= K271), G296 (= G298), T297 (≠ D299), M298 (= M300), C322 (= C324), E323 (= E325), L324 (≠ F326)
- binding manganese (ii) ion: D194 (= D196), E220 (= E222), T235 (≠ R237), N238 (≠ I240), D245 (= D247)
Sites not aligning to the query:
2chrA A re-evaluation of the crystal structure of chloromuconate cycloisomerase (see paper)
29% identity, 81% coverage: 65:370/377 of query aligns to 61:367/370 of 2chrA
- active site: T137 (≠ S141), K163 (= K166), K165 (= K168), D194 (= D196), N196 (= N198), E220 (= E222), D245 (= D247), E246 (= E248), S247 (= S249), S267 (= S269), K269 (= K271), G296 (= G298), T297 (≠ D299), M298 (= M300), C322 (= C324), E323 (= E325), L324 (≠ F326)
- binding manganese (ii) ion: D194 (= D196), E220 (= E222), D245 (= D247)
Sites not aligning to the query:
3q4dA Crystal structure of dipeptide epimerase from cytophaga hutchinsonii complexed with mg and dipeptide d-ala-l-ala (see paper)
26% identity, 85% coverage: 38:358/377 of query aligns to 32:351/368 of 3q4dA
- active site: P50 (= P56), T53 (≠ V59), T135 (≠ S139), K160 (= K166), K162 (= K168), D190 (= D196), N192 (= N198), E216 (= E222), D241 (= D247), E242 (= E248), S243 (= S249), K265 (= K271), G292 (= G298), G293 (≠ D299), F294 (≠ M300), Y317 (vs. gap), D318 (≠ E325), F319 (= F326)
- binding alanine: K162 (= K168), K265 (= K271), G293 (≠ D299)
- binding d-alanine: K162 (= K168), G293 (≠ D299), D318 (≠ E325), D320 (≠ Y327), T321 (≠ Q328)
- binding magnesium ion: D190 (= D196), E216 (= E222), D241 (= D247)
Sites not aligning to the query:
3q45A Crystal structure of dipeptide epimerase from cytophaga hutchinsonii complexed with mg and dipeptide d-ala-l-val (see paper)
26% identity, 85% coverage: 38:358/377 of query aligns to 32:351/368 of 3q45A
- active site: P50 (= P56), T53 (≠ V59), T135 (≠ S139), K160 (= K166), K162 (= K168), D190 (= D196), N192 (= N198), E216 (= E222), D241 (= D247), E242 (= E248), S243 (= S249), K265 (= K271), G292 (= G298), G293 (≠ D299), F294 (≠ M300), Y317 (vs. gap), D318 (≠ E325), F319 (= F326)
- binding d-alanine: K162 (= K168), D318 (≠ E325), D320 (≠ Y327), T321 (≠ Q328)
- binding magnesium ion: D190 (= D196), E216 (= E222), D241 (= D247)
- binding valine: K160 (= K166), K162 (= K168), D190 (= D196), K265 (= K271), G293 (≠ D299), F294 (≠ M300)
Sites not aligning to the query:
3fvdB Crystal structure of a member of enolase superfamily from roseovarius nubinhibens ism complexed with magnesium
26% identity, 95% coverage: 8:366/377 of query aligns to 4:358/367 of 3fvdB
- active site: S136 (= S141), S161 (≠ K166), K163 (= K168), D192 (= D196), N194 (= N198), E216 (= E222), D239 (= D247), E240 (= E248), K263 (= K271), E290 (≠ G298), D291 (= D299), V292 (≠ M300), A316 (≠ E325), S317 (≠ F326), W318 (≠ Y327)
- binding magnesium ion: D192 (= D196), E216 (= E222), D239 (= D247), E240 (= E248)
3r1zB Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : complex with l- ala-l-glu and l-ala-d-glu (see paper)
29% identity, 83% coverage: 3:316/377 of query aligns to 6:313/364 of 3r1zB
- active site: F20 (≠ S17), A51 (≠ P56), A54 (≠ V59), S136 (= S141), K161 (= K166), K163 (= K168), D191 (= D196), N193 (= N198), E219 (= E222), D244 (= D247), E245 (= E248), S246 (= S249), K268 (= K271), G295 (= G298), C296 (≠ D299), M297 (= M300)
- binding alanine: S136 (= S141), K163 (= K168), C296 (≠ D299)
- binding d-glutamic acid: F20 (≠ S17), R25 (≠ S22), I55 (≠ F60), K163 (= K168), D191 (= D196), D244 (= D247), K268 (= K271), M297 (= M300), M298 (≠ F301)
Sites not aligning to the query:
Query Sequence
>WP_085635947.1 NCBI__GCF_002115805.1:WP_085635947.1
MGDIDQNIIGFDLWYLSLPVVSARDHGIGRVDGACEVIVLRLTAEGGETGWGEASPWVVF
TGSPEATYAALNRYIRPLVLGRRVSDRDAIMLDASRAVAHCTEAKAALDTALLDLEGRIS
GQPVHALLGGKCRDSIPLSVSLANPDFDQDRALLDRLQADGVRIVKLKTGFRDHAFDLMR
LEALARDYPDFAVRVDFNQGLEPEGALQRVQDIAGFRPDFIEQPVRAPLYDLMAEIRRAI
DVPLLADESVFGPEDMARAIREGICDGVSVKIMKSGSMARGQAVANMAAAHGLGAYGGDM
FEAGLAHLAGAHMIVATRAIDLGCEFYQARYYLAEDILETPFPCDGGRVQVPDGPGLGIR
PDVDKLNHYGIAKGLAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory