Comparing WP_085638029.1 NCBI__GCF_002115805.1:WP_085638029.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
1us4A Putative glur0 ligand binding core with l-glutamate (see paper)
24% identity, 87% coverage: 30:313/327 of query aligns to 3:293/297 of 1us4A
Sites not aligning to the query:
8s4jA Structure, substrate selectivity determinants and membrane interactions of a glutamate-specific taxi trap binding protein from vibrio cholerae. (see paper)
23% identity, 86% coverage: 32:313/327 of query aligns to 6:295/300 of 8s4jA
>WP_085638029.1 NCBI__GCF_002115805.1:WP_085638029.1
MKFTALTGAVVVAAFTATMSVAQDRTGWPESFTVGTGSQGGTYFGYGSGWAGIVSEVLGV
SGGAEVTGGPMQNMALVHTGDLPFGMTTMGPAAESIAGSNPIAPGLPMTNACAMFPMYQT
PFSVTALSSSGITSISEIPDGARIGFGPAGSTSDTYFPRMMEELGVNFERRNGGWSDLGG
QLQDGLLDVIAFAAGVPVPAVSQLEVQTDINIIEFTEEEQAKITAAFPVANFEISADAYT
TLEAPARSVSMWNFAIANCDLPETFVYEVVNAVMSDNERMVNTHRAARSTLPEFWDRNTV
MKWHPGAARWFTENAGAEIAADMIHGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory