Comparing WP_085639258.1 NCBI__GCF_002115805.1:WP_085639258.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
36% identity, 73% coverage: 3:264/360 of query aligns to 298:540/560 of 3bofA
Sites not aligning to the query:
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
36% identity, 73% coverage: 3:264/360 of query aligns to 298:540/559 of 1q8jA
2ycjA Methyltransferase bound with methyltetrahydrofolate (see paper)
32% identity, 67% coverage: 21:261/360 of query aligns to 10:237/271 of 2ycjA
2yciX Methyltransferase native (see paper)
32% identity, 67% coverage: 21:261/360 of query aligns to 10:237/271 of 2yciX
4o1eA Structure of a methyltransferase component in complex with mthf involved in o-demethylation (see paper)
34% identity, 68% coverage: 21:264/360 of query aligns to 5:234/271 of 4o1eA
Sites not aligning to the query:
2yckX Methyltransferase bound with tetrahydrofolate (see paper)
32% identity, 67% coverage: 21:261/360 of query aligns to 11:238/272 of 2yckX
4o1fA Structure of a methyltransferase component in complex with thf involved in o-demethylation (see paper)
34% identity, 68% coverage: 21:264/360 of query aligns to 2:230/267 of 4o1fA
4djfA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate and ti(iii) citrate reductant (see paper)
33% identity, 66% coverage: 23:260/360 of query aligns to 3:227/262 of 4djfA
4djeA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate (see paper)
33% identity, 66% coverage: 23:260/360 of query aligns to 3:227/262 of 4djeA
4djdA Crystal structure of folate-free corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr) (see paper)
33% identity, 66% coverage: 23:260/360 of query aligns to 3:227/262 of 4djdA
2e7fA 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase complexed with methyltetrahydrofolate to 2.2 angsrom resolution (see paper)
33% identity, 66% coverage: 23:260/360 of query aligns to 3:227/262 of 2e7fA
Q46389 5-methyltetrahydrofolate:corrinoid/iron-sulfur protein co-methyltransferase; 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase; MeTr; EC 2.1.1.258 from Moorella thermoacetica (Clostridium thermoaceticum) (see 2 papers)
33% identity, 66% coverage: 23:260/360 of query aligns to 3:227/262 of Q46389
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
30% identity, 84% coverage: 18:318/360 of query aligns to 329:624/841 of 8g3hA
Sites not aligning to the query:
5vooA Methionine synthase folate-binding domain with methyltetrahydrofolate from thermus thermophilus hb8 (see paper)
32% identity, 67% coverage: 21:262/360 of query aligns to 2:239/282 of 5vooA
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
28% identity, 69% coverage: 21:268/360 of query aligns to 371:619/1265 of Q99707
Sites not aligning to the query:
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
28% identity, 69% coverage: 21:268/360 of query aligns to 331:579/611 of 4cczA
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
25% identity, 74% coverage: 15:280/360 of query aligns to 350:616/1227 of P13009
Sites not aligning to the query:
3k13C Structure of the pterin-binding domain metr of 5- methyltetrahydrofolate-homocysteine methyltransferase from bacteroides thetaiotaomicron
25% identity, 68% coverage: 21:263/360 of query aligns to 4:247/287 of 3k13C
>WP_085639258.1 NCBI__GCF_002115805.1:WP_085639258.1
MTRTIVESKTKTAIIGFDQPFCVIGERINPTGRKILNEELERGDFSRVEADALAQVAAGA
NILDINSGAVFSNKMAEDPRYADNNFVEPTLMKELVERVQAVTDCPLCIDSSVPGALENG
LAAAEGRPLLNSVTGEEERLELVLPLVKKYNVPVVAISNDDTGISEDPDVRFAVAKKIVE
RAADFGIPAHDIVVDPLVMPIGAMGTAGLQVFTLVRRLREELGVNTTCGASNISFGLPNR
HGINNAFLPMAMGAGMTSAIMNPVALPVGPTKIAEKRAEVAAAGIMLPEDMDDETFCTIF
GLGSTKPRPGKEMEAIRAANFLTNNDEGGGAWIAFNRQPPKAGQEGRGREGRTGGRRRRA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory