Comparing WP_085641408.1 NCBI__GCF_002115805.1:WP_085641408.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3e0iA Cu2+ substituted aquifex aeolicus kdo8ps in complex with pep (see paper)
53% identity, 93% coverage: 17:269/272 of query aligns to 3:255/263 of 3e0iA
2a21A Aquifex aeolicus kdo8ps in complex with pep, po4, and zn2+ (see paper)
53% identity, 93% coverage: 17:269/272 of query aligns to 3:255/263 of 2a21A
1jcyA Aquifex aeolicus kdo8p synthase in complex with r5p, pep and cadmium (see paper)
53% identity, 93% coverage: 17:269/272 of query aligns to 3:255/263 of 1jcyA
1fwwA Aquifex aeolicus kdo8p synthase in complex with pep, a5p and cadmium (see paper)
53% identity, 93% coverage: 17:269/272 of query aligns to 3:255/263 of 1fwwA
1fwtA Aquifex aeolicus kdo8p synthase in complex with pep, e4p and cadmium (see paper)
53% identity, 93% coverage: 17:269/272 of query aligns to 3:255/263 of 1fwtA
3undB Substrate-bound crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia pseudomallei (see paper)
51% identity, 97% coverage: 9:271/272 of query aligns to 12:276/284 of 3undB
2nx3D Structural and mechanistic changes along an engineered path from metallo to non-metallo kdo8p synthase (see paper)
53% identity, 93% coverage: 17:269/272 of query aligns to 2:254/262 of 2nx3D
2nx1A Structural and mechanistic changes along an engineered path from metallo to non-metallo kdo8p synthase (see paper)
53% identity, 93% coverage: 17:269/272 of query aligns to 3:255/263 of 2nx1A
3e12A Cu2+ substituted aquifex aeolicus kdo8ps in complex with kdo8p (see paper)
52% identity, 93% coverage: 17:269/272 of query aligns to 3:250/258 of 3e12A
1g7vA Crystal structures of kdo8p synthase in its binary complexes with the mechanism-based inhibitor (see paper)
48% identity, 100% coverage: 2:272/272 of query aligns to 4:276/284 of 1g7vA
1pe1A Aquifex aeolicus kdo8ps in complex with cadmium and 2-pga (see paper)
52% identity, 93% coverage: 17:269/272 of query aligns to 4:250/258 of 1pe1A
1pcwA Aquifex aeolicus kdo8ps in complex with cadmium and app, a bisubstrate inhibitor (see paper)
52% identity, 93% coverage: 17:269/272 of query aligns to 3:249/257 of 1pcwA
1pckA Aquifex aeolicus kdo8ps in complex with z-methyl-pep (see paper)
52% identity, 93% coverage: 17:269/272 of query aligns to 3:250/258 of 1pckA
1g7uA Crystal structures of kdo8p synthase in its binary complex with substrate phosphoenol pyruvate (see paper)
48% identity, 100% coverage: 2:272/272 of query aligns to 4:276/284 of 1g7uA
1jcxA Aquifex aeolicus kdo8p synthase in complex with api and cadmium (see paper)
51% identity, 93% coverage: 17:269/272 of query aligns to 3:247/255 of 1jcxA
1x6uA Kdo8p synthase in it's binary complex with the product kdo8p (see paper)
47% identity, 100% coverage: 2:272/272 of query aligns to 4:264/272 of 1x6uA
1phwA Crystal structure of kdo8p synthase in its binary complex with substrate analog 1-deoxy-a5p (see paper)
47% identity, 100% coverage: 2:272/272 of query aligns to 4:264/272 of 1phwA
1phqA Crystal structure of kdo8p synthase in its binary complex with substrate analog e-fpep
47% identity, 100% coverage: 2:272/272 of query aligns to 4:264/272 of 1phqA
1gg0A Crystal structure analysis of kdop synthase at 3.0 a (see paper)
47% identity, 100% coverage: 2:272/272 of query aligns to 4:267/275 of 1gg0A
3fyoD Crystal structure of the triple mutant (n23c/d247e/p249a) of 3-deoxy- d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis (see paper)
43% identity, 99% coverage: 4:271/272 of query aligns to 3:256/261 of 3fyoD
>WP_085641408.1 NCBI__GCF_002115805.1:WP_085641408.1
MKTVSIGDISVSNTAPFALIAGPCQLESLDHARMLATRIAAAAEATDTPWIFKASYDKAN
RSSLKGKRGLGMDEGLTILDRIKAEFGVPVLTDIHTAEQCAPVAQVVDVLQIPAFLSRQT
DLLLAAGETGAAINVKKGQFLAPWDMENVAAKIASTGNERILLCERGASFGYNMLVSDMR
SLPIMAQTGYPVVFDATHSVQLPGGQGTSSGGQREFVPHLARAAVAVGCAAVFIETHDAP
DNAPSDGPNMVPIDQLKGLLLVMRRIDRVVKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory