Comparing WP_085769979.1 NCBI__GCF_002117405.1:WP_085769979.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
44% identity, 81% coverage: 5:91/107 of query aligns to 114:200/200 of 6j2lA
Sites not aligning to the query:
6j2lB Crystal structure of bi-functional enzyme (see paper)
47% identity, 60% coverage: 28:91/107 of query aligns to 122:185/185 of 6j2lB
Sites not aligning to the query:
7bgnA Crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
35% identity, 73% coverage: 14:91/107 of query aligns to 126:203/204 of 7bgnA
Sites not aligning to the query:
7bgmA Crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
37% identity, 73% coverage: 14:91/107 of query aligns to 136:212/213 of 7bgmA
Sites not aligning to the query:
>WP_085769979.1 NCBI__GCF_002117405.1:WP_085769979.1
MSFSLDDLARIIRTRREATEEASYTKSLFVAGTPRIAKKFGEEAVETVIAALGEDKQALA
GEIADVLYHLLVLMEAREIALTDVLAELERRTGQSGLAEKAARGKPS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory